Details for Chickpea Locus 72700

Position : chr5 ( 5`- 46477455 .. 46478198 -3` )
Annotation :
External links : CoGe
PGDD synteny : 72700

Protein [Map View]
MASSLGIACGGNNHFAAGICGQKRCDVNRVVSCSIAIGDWTRSTVRKGRISAAAATVTARGQENFRTIVERQGKRGGERS
DAVEAQEKLDRWMRDSVVEIVKNLKEAPLLVQVFTKRKGETVTLATEKELVVGDWETVKERWETGETPLPEGVIFVEELG
GDEAEDGGESGRKERTTKVWGVVVQGKGVGCDPVCYLLKTSRVGSGPGTGMGVFSTHFCLVRVKSFRETAQSQLKNSWLL
QSHWLQQ*

DNA
ATGGCGTCGTCATTAGGCATTGCCTGCGGCGGAAACAACCATTTCGCCGCTGGAATTTGTGGTCAGAAGAGGTGCGATGT
CAATCGAGTGGTATCGTGTTCCATCGCGATTGGTGATTGGACTCGATCGACGGTGAGGAAAGGGAGAATCTCGGCGGCGG
CGGCGACTGTGACAGCGAGAGGACAAGAGAATTTTAGGACGATTGTGGAACGGCAGGGGAAGCGCGGGGGAGAGAGGAGC
GACGCCGTTGAGGCTCAGGAGAAGCTTGATAGGTGGATGAGGGATTCAGTGGTGGAGATTGTGAAGAATTTGAAGGAAGC
GCCGTTGCTAGTGCAAGTTTTTACAAAGAGGAAGGGTGAAACGGTGACGCTGGCGACGGAGAAGGAATTGGTGGTGGGTG
ATTGGGAAACGGTGAAGGAGAGATGGGAGACGGGGGAGACGCCGTTGCCGGAGGGTGTTATATTTGTGGAGGAGTTGGGC
GGTGATGAGGCGGAGGATGGTGGCGAAAGTGGGAGAAAAGAAAGAACTACGAAGGTATGGGGGGTAGTTGTTCAGGGGAA
AGGTGTCGGGTGTGACCCGGTTTGTTATTTGTTGAAAACGAGTCGGGTTGGATCCGGACCCGGTACTGGAATGGGTGTTT
TCTCGACCCACTTTTGCTTGGTGAGAGTGAAGAGTTTCAGGGAAACCGCACAGTCTCAACTTAAGAATAGTTGGCTATTG
CAAAGTCACTGGCTACAACAGTGA