Details for Chickpea Locus 72663

Position : chr5 ( 5`- 46423126 .. 46424440 -3` )
Annotation :
External links : CoGe
PGDD synteny : 72663

Protein [Map View]
MNVIFPAKRKLLVKELLQGKEYATQLKFLLKNPIASHGSPSVKELMTNVLRSFSHTXXXXXLSVINSSQPSSSAVNYSGE
DFRSEDSSESRKRLLPTTTKDRRGSYKRRKSEETRNIVSQTTDDIHSWRKYGQKEILNSQFPRSYYRCTRKHDQGCKATK
QVQRIEENPDMYQITYIGFHTCKSTLQTPQMVTFSDTNNNWDSFLVNFHHHSKVLNYDQHDDPLISTSQIRPNVKQEYLN
DERSELTEDLLDPNLWCDLKDFELSKPAINLSFNTVVSDTVYSSTESQNLEIDFGVFSSDFSNDLIYFDESHLI*

DNA
ATGAATGTTATTTTCCCTGCTAAGAGGAAGCTACTAGTAAAAGAGCTTCTTCAAGGTAAAGAGTATGCTACACAGTTAAA
GTTTCTGCTTAAGAACCCTATTGCCTCTCATGGATCTCCCTCGGTTAAAGAATTGATGACCAATGTGCTCAGATCTTTCT
CCCACACTNNNNNNNNNNNNNNTCTTTCTGTCATTAATTCTTCTCAACCTTCTAGCTCTGCTGTCAATTATTCAGGGGAA
GATTTCAGGTCTGAAGATTCAAGTGAGAGTAGGAAGAGATTGTTACCTACCACCACAAAGGATCGAAGAGGTTCCTATAA
AAGAAGAAAGAGTGAAGAGACACGAAACATAGTCTCTCAAACCACTGATGACATTCATTCATGGAGAAAGTACGGACAGA
AGGAAATCCTCAATTCTCAATTCCCAAGGAGTTACTATAGGTGCACACGAAAACATGATCAAGGTTGCAAAGCAACAAAA
CAAGTACAACGTATAGAAGAGAATCCAGATATGTACCAAATTACATACATTGGATTTCACACATGCAAATCCACTTTACA
AACTCCACAAATGGTCACATTTTCTGATACTAATAATAATTGGGATTCATTTCTTGTGAATTTTCATCATCATTCAAAGG
TTCTAAATTATGATCAACATGATGATCCCCTTATAAGTACCTCACAAATTAGGCCAAATGTGAAACAAGAATATCTCAAC
GATGAAAGGAGTGAACTTACTGAAGATTTGTTGGATCCTAATTTGTGGTGTGATTTAAAGGATTTTGAACTGTCCAAGCC
TGCCATTAATTTAAGCTTTAATACTGTTGTTTCTGATACTGTGTATTCATCTACTGAATCTCAAAATCTGGAAATTGATT
TTGGGGTGTTTTCTTCTGATTTCAGCAATGATTTGATATATTTTGATGAAAGTCATTTGATTTAA