Details for Chickpea Locus 72649

Position : chr5 ( 5`- 46402012 .. 46404576 -3` )
Annotation :
External links : CoGe
PGDD synteny : 72649

Protein [Map View]
MIMKSESSIQEINAAPRNGLNPASEGRQSSDRERQAPRQKDSLKAKATASSRECYSDGNGEYNGGQLVPFKFSDEELESE
SDDKLSLRRHRVSNKGGSNKITHCEIEEINNGEFSLERSKEELIYSSDEDGNDDKSALIGDSSEMPITESNYQGAEELNK
GNLSQEGAEHELISGSDEEDANKEKSVTAGANLEMEIIGSGLKGVEDLNNSNLPLKDAEEELNSGIDGEDANNDKPVLVG
ENLEEEVTENNIAGEKLYNGKRPLDKEDHNNDQSAIEDTKSEVDTTEGTTTKNPRTENVDKLDATESRDHSSELSGVLGI
GKLSESPITRSSYAYNGRLSSHDGMNERANERFAIQSLDSLKNSYTTDEGRIRKGKGLASSSLYGDLGTQHQSHIPQEKH
HVMKESRKNQNKVLENTTLGNYHLMKTKRDHKFPSKVPFPRSGYNSHYENIRPSNRMHDESSSILSHDSHEDTDMEKVKL
LRIIYKLQDQLNKTRHISQERNGNSSAAYHSHELHEGKFSHAHEQDSRCNGRCNNHGITWHQRHKYSRRPYSAEETSCVH
DVDHFCFHSRSHVSADLSPRILFQRKDLYRSYRGRDCCSSSPQRFAASKLPLYGSETHSNDQRYRATAVRKYLREKPNLA
KRHQKPVAGGAPFVTCHKCLNLLQLPADFLLYKRACHKLKCGQCSEVLKFSLKNGSHVVPFSSNTTGLPSSEIHHQSEAS
RGGNLPSVSHVNYYHYSPAKPISYYDDYELSVSQSYSSEVDPVFLTEQFHHLHGNEYVNPNVSPSSTFKENIASRYSSTP
KAPMETDESAEFSSNMSESRNLPAEKVAMPQLRSSPHKLMGYSTPSQVIRGTSC*

DNA
ATGATTATGAAATCAGAATCCAGTATACAAGAAATCAATGCAGCTCCTAGAAACGGATTGAATCCTGCTTCTGAGGGTAG
ACAAAGTAGCGACAGAGAGCGTCAGGCTCCTCGCCAGAAAGATAGTTTGAAGGCTAAAGCAACTGCTTCTTCAAGAGAAT
GTTATTCAGATGGAAATGGTGAATACAATGGCGGTCAGTTAGTACCGTTCAAGTTCTCAGATGAAGAACTAGAAAGTGAG
TCGGACGATAAATTGTCACTCAGAAGGCATAGAGTCTCCAACAAAGGCGGTTCAAATAAGATCACTCACTGTGAGATTGA
AGAGATAAATAATGGGGAGTTCTCATTAGAAAGATCAAAAGAGGAGTTAATTTATTCATCTGATGAAGATGGCAATGATG
ACAAATCAGCTCTGATAGGGGACAGTTCTGAAATGCCAATTACTGAAAGTAATTATCAAGGAGCAGAAGAGTTAAACAAA
GGAAACTTGTCACAAGAGGGAGCAGAACATGAGTTAATTTCTGGATCAGATGAGGAAGATGCCAATAAAGAGAAGTCGGT
GACAGCAGGTGCAAACCTTGAAATGGAAATTATTGGAAGTGGTTTAAAAGGAGTAGAAGACTTGAATAATAGCAACTTGC
CACTAAAAGATGCAGAAGAGGAGTTAAATTCTGGAATTGATGGAGAAGATGCCAATAATGATAAACCGGTTTTAGTTGGT
GAAAACCTTGAGGAGGAAGTTACTGAAAACAATATAGCAGGAGAAAAATTATATAATGGAAAAAGACCACTTGATAAAGA
AGATCACAACAATGACCAATCAGCTATAGAGGATACAAAATCGGAAGTGGACACTACAGAAGGTACTACTACAAAAAATC
CAAGAACTGAAAATGTGGATAAATTAGATGCCACAGAATCAAGAGATCATAGTTCAGAGCTTAGCGGTGTTCTTGGAATA
GGAAAACTGTCTGAATCCCCAATCACCAGAAGCTCTTATGCTTACAATGGCAGACTCTCTTCTCATGATGGAATGAATGA
GCGGGCAAATGAGCGATTCGCTATCCAAAGTTTAGATTCTTTGAAGAACTCTTACACCACTGATGAGGGAAGGATCCGAA
AGGGTAAAGGCCTTGCTAGTAGCTCCTTATATGGTGATCTTGGAACGCAACATCAATCACATATACCCCAGGAAAAGCAT
CATGTCATGAAAGAGAGCAGAAAGAATCAAAACAAAGTGTTGGAAAATACAACACTTGGTAATTACCATTTGATGAAAAC
AAAGAGAGATCACAAGTTTCCGTCCAAAGTGCCTTTCCCTCGAAGTGGTTACAATTCACACTATGAAAATATCAGGCCAT
CAAATAGAATGCATGATGAGAGCTCAAGCATTCTTTCGCATGACTCACATGAGGACACTGACATGGAGAAGGTGAAACTG
TTGAGAATTATTTATAAGTTGCAGGATCAACTTAACAAGACTCGCCATATAAGTCAGGAAAGAAATGGAAACAGTTCTGC
TGCATATCATAGCCATGAACTTCATGAGGGAAAGTTTTCTCATGCTCATGAACAAGACTCTAGGTGTAACGGAAGATGTA
ATAATCATGGAATCACATGGCACCAAAGGCATAAATACTCACGGAGACCTTATTCAGCTGAGGAAACAAGCTGTGTGCAT
GATGTTGATCATTTTTGTTTCCATTCCCGTTCCCATGTCTCAGCAGATTTGTCTCCACGCATTCTTTTCCAACGTAAAGA
TTTATACAGGTCATATCGAGGGAGAGATTGTTGCTCGTCAAGTCCACAACGCTTCGCAGCCTCTAAACTCCCATTATATG
GCAGTGAGACGCATTCTAATGATCAGAGGTATAGGGCTACAGCGGTGAGGAAATATTTAAGGGAGAAACCGAACTTGGCT
AAGCGACATCAGAAGCCAGTAGCAGGTGGAGCTCCTTTTGTCACTTGTCATAAATGCTTAAATCTTCTGCAGCTACCTGC
AGATTTTCTTCTTTATAAAAGGGCATGTCATAAGCTGAAATGTGGTCAATGTTCAGAGGTACTCAAGTTTTCACTGAAGA
ATGGAAGTCATGTGGTTCCTTTTTCATCAAACACTACAGGTCTTCCATCTAGTGAGATTCATCATCAAAGTGAGGCAAGT
AGAGGCGGCAATCTACCATCAGTATCTCATGTCAACTATTACCATTATTCACCTGCAAAACCTATTTCATATTATGATGA
TTATGAGCTATCCGTCTCTCAAAGCTACTCCTCAGAAGTAGATCCTGTTTTTCTTACCGAACAATTTCATCACTTGCATG
GCAATGAATATGTTAACCCAAACGTCTCTCCTAGCTCAACATTTAAGGAGAATATTGCTTCAAGATATTCTAGTACACCC
AAGGCTCCAATGGAGACAGATGAATCAGCTGAATTTTCCTCCAATATGTCTGAATCTAGGAATTTGCCAGCAGAAAAGGT
GGCAATGCCACAACTAAGAAGTTCACCTCATAAACTGATGGGTTATTCTACACCAAGTCAAGTGATAAGAGGGACATCTT
GTTGA