Details for Chickpea Locus 72635

Position : chr5 ( 5`- 46368635 .. 46372412 -3` )
Annotation :
External links : CoGe
PGDD synteny : 72635

Protein [Map View]
MSRGRCGCSQRITQLQQLFLRQPFTSSSPHPPPLHNPSSTFLFAPHPKPTLSSFLHSPPIFYPSAARFGVFRFFSSKTPN
LGFNAKKVFDKPTAALTSAFSRYREAIVLQLEAFFKRNQLFLFGAAAVLLCAVLWRILFGVANTFVSFSEGMAKYGFLAL
SSAIVAFAGLYIRSRFTINPDKVYRMAMTRLNTSAQILEVMGAPLTGTDLRAYVMSGGGLTLKKIKPSLRSRRCFLIFPI
KGAERKGLVNVEVKKKKGKYDMKLLAVDVPMASGPDQRLYVIGDEEEYRVGGGLISVLRDPVVKAMAATKEFDNLDEIEE
EEDAERERQEAERERQEAERKHREEIEKIENSNT*

DNA
ATGTCAAGAGGAAGATGCGGTTGTTCACAGAGAATCACTCAACTCCAACAACTTTTTCTCCGCCAACCGTTCACTTCTTC
ATCTCCTCATCCTCCTCCACTTCACAACCCTTCTTCAACTTTTCTATTCGCACCTCACCCAAAACCAACCCTCTCTTCAT
TCCTCCACTCACCGCCGATTTTCTACCCTTCCGCCGCGCGATTCGGTGTATTCAGATTCTTCTCCTCAAAGACACCCAAC
CTTGGCTTCAATGCTAAGAAGGTTTTCGACAAACCTACGGCTGCGTTGACCTCTGCTTTCTCTCGTTATCGTGAGGCCAT
TGTATTGCAACTCGAAGCTTTCTTCAAGAGAAATCAATTGTTTTTGTTTGGTGCTGCTGCAGTTCTTCTATGTGCTGTTT
TATGGAGGATTCTCTTTGGCGTTGCAAATACCTTCGTGTCCTTTTCTGAAGGCATGGCTAAGTATGGCTTCCTTGCACTT
TCTTCTGCTATCGTTGCTTTCGCTGGTTTGTATATCCGCTCAAGGTTCACAATCAACCCTGATAAAGTGTATAGAATGGC
CATGACAAGACTTAACACATCTGCTCAGATTCTTGAAGTTATGGGTGCCCCGCTTACAGGAACTGATTTAAGAGCCTATG
TTATGTCAGGGGGTGGCCTTACATTAAAGAAAATCAAGCCAAGTCTTAGGAGCCGACGTTGTTTTCTCATTTTCCCCATA
AAAGGTGCTGAGAGAAAGGGTCTAGTCAATGTTGAAGTCAAGAAAAAGAAGGGCAAGTATGATATGAAGCTGCTGGCCGT
TGATGTTCCCATGGCTTCTGGCCCAGACCAGCGTTTGTATGTGATAGGGGATGAAGAAGAGTACAGGGTTGGTGGGGGAC
TGATATCTGTGCTAAGAGACCCTGTGGTGAAAGCAATGGCAGCAACCAAAGAATTTGACAATCTTGATGAGATCGAGGAA
GAGGAGGATGCTGAAAGAGAACGTCAGGAGGCTGAAAGAGAACGTCAAGAGGCTGAACGAAAGCACCGTGAAGAAATTGA
AAAGATTGAAAATAGTAATACATAG