Details for Chickpea Locus 72616

Position : chr5 ( 5`- 46342303 .. 46346629 -3` )
Annotation :
External links : CoGe
PGDD synteny : 72616

Protein [Map View]
MEALLCRKLGDPTVSVEDDNSSIIVSKNHPIPQLDSPTSVRVRIKATSLNFANYLQIFGKYQEKPPLPFIPGSDFSGIVD
SVGAKVTNFRVGDPVCSFAALGSYAQYIVVDQSQLFRVPEGCDLVAAGALAVAFGTSHVALVHRAQLKSGQVLLVLGAAG
GVGLAAVQIGKACGAIVIAVARGAEKVQILKSLDVDHVVDLGNENVTESVKEFLKGRRLKGIDVLYDPVGGKLMKESLKL
LKWGANILIIGFASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPGVLEDSLKELLSWLAKGLISIHISHSYSLSEANLA
FSAIRDRKAIGKVMIVFDDKVTRSKL*

DNA
ATGGAAGCGCTATTGTGCAGGAAATTGGGAGACCCAACTGTGAGCGTCGAAGACGATAACAGCTCAATAATCGTATCAAA
AAATCACCCAATCCCTCAATTGGACTCTCCAACTTCGGTCAGAGTTAGGATCAAAGCCACAAGCTTGAATTTCGCTAATT
ACTTGCAAATTTTCGGTAAGTATCAGGAAAAACCCCCTTTGCCATTCATTCCCGGATCCGATTTTTCAGGCATCGTAGAT
TCCGTTGGCGCCAAAGTTACCAACTTCCGTGTCGGAGATCCTGTTTGTTCCTTCGCCGCTCTTGGCTCTTATGCGCAATA
TATTGTTGTTGATCAATCCCAATTGTTTCGCGTGCCGGAAGGTTGTGATTTGGTTGCTGCTGGAGCACTTGCTGTGGCAT
TTGGCACTTCTCATGTTGCACTTGTTCATAGAGCACAATTGAAATCTGGTCAGGTATTGTTGGTTTTGGGTGCGGCTGGA
GGTGTGGGTCTTGCAGCTGTGCAAATTGGAAAAGCATGTGGGGCCATTGTTATTGCTGTTGCCAGGGGAGCTGAAAAGGT
GCAGATCTTGAAATCACTCGATGTTGATCATGTGGTGGACTTGGGTAATGAAAATGTCACTGAGAGTGTCAAAGAGTTCC
TTAAGGGAAGAAGGCTTAAAGGGATCGATGTCCTGTATGACCCAGTCGGTGGCAAGCTTATGAAAGAATCTTTGAAGCTT
CTGAAATGGGGAGCTAACATTCTGATAATTGGGTTTGCAAGTGGAGAGATTCCTGTCATCCCTGCTAACATAGCTCTTGT
CAAGAATTGGACAGTACATGGCCTTTATTGGGGTAGTTATAAAATACACCGCCCAGGTGTTCTTGAAGATTCTCTCAAGG
AGCTACTCTCTTGGTTGGCAAAAGGCTTGATTTCCATTCACATTTCTCATTCTTACAGCCTGTCAGAGGCCAACCTCGCC
TTCTCTGCCATCAGAGATAGGAAAGCTATAGGGAAGGTGATGATTGTATTCGATGATAAAGTTACAAGATCTAAGCTGTG
A