Details for Castor bean Locus 29813.m001546

Position : 29813 ( 5`- 604412 .. 603321 -3` )
Annotation : hypothetical protein
External links : CoGe
PGDD synteny : 29813.m001546

Protein [Map View]
MEVSGVAPSRRNLSLDQFQKEGSSDAQVQSFELGLYDDNDGHNNHQFHSMNALEILRETVRILRCNSSSFMIIAALLICP
VSAIVLSNVFVDQSIVKRLTIRLLLVAKSSGLPLRPFVKQSCHHLSEMAIASAMYFPLFITLSLLSKAAVVYSVDCTYSR
QNIDVSKFIGIMSKIWRRVVSTYWWACMMIVGCITLFCVLLLAICSLLSVIGFPPALNLYAGILVGLVFSVVFANAIVIC
NIAIVISVLEDVSGPQALLRSSILIRGQTQVGLLIYLGSTIGLAFVEGLFEHRVKTLSYGDGSSRIWEGPLLVIMYSFVV
LIDLMMSAIFYFSCRSYRTEASDAESQSILETISISDESVGVQ

DNA
ATGGAAGTTTCTGGTGTTGCTCCTTCAAGGAGGAACTTGAGCTTGGATCAGTTCCAAAAGGAAGGATCTTCGGATGCCCA
GGTACAGAGTTTTGAGCTAGGATTGTACGATGATAATGATGGGCATAATAATCATCAATTTCATTCAATGAATGCATTGG
AGATCTTGAGAGAAACTGTGAGGATTCTTCGGTGCAATTCCTCATCGTTTATGATAATTGCTGCATTGCTTATTTGTCCA
GTATCTGCCATTGTTTTGTCAAATGTGTTTGTTGATCAGTCTATTGTGAAAAGACTTACCATTAGGCTTTTGTTGGTTGC
AAAGTCTAGTGGACTCCCATTGAGGCCTTTTGTCAAACAGTCTTGTCACCATTTGTCCGAGATGGCTATTGCTTCAGCAA
TGTACTTCCCTTTGTTTATCACATTGTCTTTGTTGTCGAAAGCTGCTGTAGTTTACTCTGTAGATTGCACTTATTCTAGG
CAGAATATAGATGTTTCGAAGTTTATAGGGATTATGAGTAAAATCTGGAGAAGGGTTGTCTCAACATACTGGTGGGCATG
TATGATGATTGTTGGCTGCATTACTCTTTTCTGTGTTCTTCTCTTGGCTATTTGTAGTTTGCTTTCCGTAATCGGGTTTC
CACCTGCGTTAAATTTGTATGCTGGAATATTGGTGGGTTTAGTATTCTCAGTTGTTTTCGCCAATGCAATTGTTATTTGC
AACATTGCTATAGTGATCTCTGTATTGGAGGATGTTTCAGGGCCACAGGCTTTGCTTCGATCCAGTATTTTGATTAGGGG
ACAGACGCAGGTCGGTCTTCTCATATATCTTGGATCAACAATTGGGTTGGCTTTTGTGGAAGGGTTGTTTGAGCATAGGG
TGAAAACATTGAGTTATGGAGATGGATCTTCGAGGATTTGGGAAGGTCCACTTTTGGTGATTATGTATTCCTTTGTAGTG
CTTATTGATCTGATGATGAGTGCAATATTCTACTTCAGTTGTAGATCTTATAGGACAGAAGCCTCTGATGCTGAATCACA
ATCAATTTTAGAAACAATCAGTATTTCTGATGAATCAGTGGGTGTTCAATAA