Details for Castor bean Locus 29813.m001545

Position : 29813 ( 5`- 600693 .. 597463 -3` )
Annotation : [B2G] protein binding
External links : CoGe
PGDD synteny : 29813.m001545

Protein [Map View]
MESYRQDKIQKFEEFVDRRLKPDLVRAIAQRDKVFEEQKVFSDLRRNIENLENNSVTSLRTLVNLGSEVYMQADVPDTQR
VFVDIGLGFHVEFTWAEALNYISLREEKIARQIEEYTRQIASIKAQIKLVCEGIRELLQLPAEKSLPGRLITLRYRYYLT
GRSAVARKIPSLRKEAIYYLEKHWHGIFDEVKAHKGKAASDAFPSNLIPP

DNA
ATGGAAAGCTACCGTCAAGATAAAATACAGAAATTTGAAGAATTTGTTGACCGCCGCTTGAAACCTGATCTTGTTCGAGC
TATTGCCCAAAGGGACAAGGTCTTTGAAGAACAGAAAGTTTTCTCGGACTTGCGAAGGAACATAGAGAACTTAGAGAATA
ATAGTGTAACCAGTCTTAGGACACTGGTTAACCTTGGCTCTGAAGTGTACATGCAAGCTGATGTCCCAGACACACAGCGC
GTATTTGTGGACATTGGACTAGGATTCCATGTAGAGTTTACATGGGCTGAAGCATTGAATTACATATCATTAAGGGAGGA
AAAAATAGCGAGGCAAATAGAAGAATATACTCGCCAAATCGCATCAATTAAAGCACAAATCAAGCTGGTTTGTGAAGGAA
TCCGGGAGTTGCTCCAGCTTCCAGCTGAGAAATCTTTACCAGGGCGGTTGATAACTCTTAGATACAGGTATTATCTGACG
GGAAGATCAGCAGTAGCTCGAAAGATACCCAGCTTAAGGAAGGAGGCTATATATTACCTGGAGAAGCATTGGCATGGTAT
CTTTGATGAAGTGAAAGCTCATAAAGGTAAGGCTGCCTCTGATGCTTTTCCTTCGAATTTGATTCCTCCCTGA