Details for Castor bean Locus 29813.m001538

Position : 29813 ( 5`- 555908 .. 554142 -3` )
Annotation : [B2G] vesicle transport v-snare protein
External links : CoGe
PGDD synteny : 29813.m001538

Protein [Map View]
MSDVFEGYERQYCELSANLSRKCNSTSLLPDAEEKKEKISEIKSGLDECDVLIRKMDLEARSLQPSVKAMLLAKLREYKS
DLNNLKREFKRITLGNPSQAELLESDLHSVSADQRERVSMSVERLNQSGDRIKESRRTMLETEELGVSILEDLHQQRQTL
LHAHNKLHGVDDAIDKSKRVLTSMSRRISKNKWIVGSVIAALVLAIIFIISFKFSHH

DNA
ATGAGCGACGTGTTCGAAGGATACGAGCGGCAGTACTGCGAGCTCTCCGCAAATCTATCCCGTAAATGTAACTCTACTTC
TCTTCTTCCCGATGCAGAGGAGAAGAAGGAGAAGATCTCCGAGATTAAATCTGGACTCGATGAGTGTGATGTCTTGATTC
GGAAAATGGACCTAGAGGCGAGAAGTTTGCAACCGAGTGTTAAAGCTATGTTACTTGCTAAATTGAGAGAATATAAGTCT
GATCTTAACAATTTGAAGAGAGAATTTAAGAGGATAACCTTGGGCAATCCTTCTCAGGCTGAACTGCTGGAATCTGATTT
GCACTCGGTTTCTGCAGATCAAAGAGAAAGAGTGTCGATGTCAGTAGAGAGACTAAACCAGTCAGGGGATAGAATTAAGG
AGAGTAGAAGAACAATGCTGGAGACTGAAGAGCTTGGTGTCTCAATTCTTGAAGACTTGCACCAACAGCGCCAGACTCTC
TTACATGCTCATAACAAGCTTCATGGAGTAGATGATGCCATTGACAAGAGTAAGAGAGTCTTGACATCTATGTCAAGAAG
AATTTCCAAAAACAAGTGGATTGTTGGCTCAGTAATCGCTGCTCTTGTGCTTGCAATCATCTTTATTATCTCATTCAAGT
TTTCTCATCACTAA