Details for Castor bean Locus 29813.m001535

Position : 29813 ( 5`- 539652 .. 542414 -3` )
Annotation : [B2G] transmembrane emp24 domain-containing protein 10
External links : CoGe
PGDD synteny : 29813.m001535

Protein [Map View]
MGTRLLDSVIIAISIVGLLSSTTESLRFDLQSGQTKCIAEDIQSNAMTVGKYSVVNPNEGQPLPTTHSLTVRVTSSYGNS
YHYAEHVPSGQFAFTAAEAGDYMTCFWAADHKPQVTLTVDFDWKTGVAAKDWTNVAKKGSIDVMELELKKLHDTVISIQE
EMYSLREREEQMQELNRATNSRMGWFSFLSLIVCLSVAGLQVWHLKTFFEKKKLI

DNA
ATGGGTACCAGATTACTTGATTCAGTTATAATTGCAATAAGCATAGTGGGTCTTTTATCTTCTACAACAGAATCACTTCG
GTTTGATTTACAATCAGGTCAAACCAAATGTATTGCGGAAGACATCCAAAGCAATGCGATGACTGTTGGCAAGTACAGCG
TTGTTAATCCTAACGAAGGCCAGCCCTTGCCTACTACACACTCGCTCACTGTTAGAGTGACATCGAGTTATGGGAATAGT
TATCACTACGCCGAGCATGTACCATCTGGGCAGTTTGCGTTTACGGCAGCGGAGGCAGGAGATTACATGACGTGTTTTTG
GGCGGCGGATCATAAGCCTCAAGTTACTTTGACTGTTGATTTTGATTGGAAAACTGGTGTCGCTGCTAAAGATTGGACAA
ATGTTGCCAAGAAAGGCTCTATTGATGTAATGGAATTAGAGCTGAAGAAGCTGCATGATACTGTTATTTCCATTCAGGAG
GAGATGTATAGTCTCCGCGAAAGAGAAGAACAAATGCAGGAGTTGAACCGAGCTACTAACTCAAGGATGGGTTGGTTTAG
TTTTCTATCTCTCATCGTATGTTTATCAGTAGCAGGCTTGCAAGTATGGCACCTGAAGACCTTTTTCGAGAAGAAGAAGC
TCATTTAA