Details for Castor bean Locus 29813.m001531

Position : 29813 ( 5`- 510673 .. 507141 -3` )
Annotation : [B2G] xenotropic and polytropic murine leukemia virus receptor
External links : CoGe
PGDD synteny : 29813.m001531

Protein [Map View]
MKFGKEFKAQMVPEWQQAYMDYDFLKTLLKEIQRFRIRNKPPQPTSLYRAFSGLMQKNNNIYSTRVAPYPSDNIESEAIL
VNSVSRDGSQSYETTFIMYCDEGGEYELAYFSKLDYEFNKVEKFYKAKVDEVMKEASMLNKQMDALIAFRIKVENFTGWN
DMSADTTQHLASDSSAAESPSETTASRRVHVIDVAEEASSQHEKADASTHSNREEEDDGISRNVVIEKHMNIRGNRAASL
EILNRVKINKKLETPRSTIKGFLKIPQRTELKFTKENLRRVEKQLKRAFVEFYHKLRLLKSFSFLNTSAFSKIMKKYDKI
TTRDASKAYMKMVDKSFLGSSDEVTKLMERVEATFIKHFSNSNRSKGMSVLRQKAKNEKHRTTFSMGFLSGCTVSLVIAL
VLIIRARNIMSEPGREAYMTTMFPLYSLFGFIVLHMLIYAANIYFWRRYRVNYSFIFGFKQGTELGYREVLLFSFGIAVL
ALMSVLANLDMEMDPETKDYKPFTELLPLNLVILLIVLLLLPFNVLYRSARFFLLTCIFHCIAAPLYKVTLQDFFLADQL
TSQVQAIRSLEFYICYYAWGDYKLRENTCKTSDVYNTFYFIVAVIPYWVRLLQCLRRLFEEKDIMQAINGGKYFVTIAAV
CLRTAYSLNKGTSWRVAAWIFSVIAALYGTYWDLVFDWGLLQRHSKNRWLRDKLLVPRKSVYFIAMVLNVLLRFAWLQTV
LNFNISSLHAETSIAIVASLEIIRRGIWNFFRLENEHLNNVGKYRAFKSVPLPFNYDEDDDKDE

DNA
ATGAAGTTTGGGAAAGAGTTCAAGGCACAAATGGTGCCAGAATGGCAACAAGCATACATGGACTACGATTTTCTTAAAAC
CCTTTTGAAAGAAATTCAAAGATTCAGAATAAGAAACAAACCACCGCAACCCACCTCATTGTACAGAGCTTTCAGTGGGT
TGATGCAGAAAAACAACAATATTTACAGCACAAGAGTAGCCCCATATCCTTCTGACAACATCGAAAGCGAAGCCATTTTG
GTGAATTCTGTGAGCCGTGATGGCTCTCAGAGCTATGAAACCACTTTCATTATGTATTGTGATGAAGGAGGAGAGTACGA
GCTGGCGTACTTCAGTAAACTTGATTATGAGTTTAACAAGGTAGAGAAGTTCTACAAGGCTAAAGTTGACGAGGTTATGA
AGGAAGCTTCTATGTTGAATAAGCAAATGGATGCCTTGATTGCCTTTAGGATCAAAGTTGAGAATTTTACTGGCTGGAAT
GATATGTCTGCTGATACAACTCAACACCTTGCTTCTGATTCTTCTGCTGCTGAGTCTCCCTCCGAAACTACAGCATCCAG
AAGAGTTCATGTTATAGATGTGGCTGAAGAAGCGTCAAGCCAGCATGAAAAAGCAGATGCATCTACTCATAGTAATAGAG
AGGAGGAAGATGATGGGATTAGCCGAAACGTAGTAATAGAGAAGCATATGAACATTAGAGGCAACCGAGCAGCTTCACTG
GAGATTTTAAACCGTGTGAAGATTAACAAAAAACTCGAGACACCTAGATCTACCATTAAAGGCTTCCTCAAAATTCCTCA
GCGTACGGAATTGAAATTCACAAAGGAAAATCTTAGGAGAGTTGAGAAGCAACTCAAGCGTGCTTTTGTCGAATTTTACC
ACAAGCTTCGCCTTCTCAAGAGTTTCAGCTTCTTGAACACATCAGCATTTTCCAAAATCATGAAGAAGTATGATAAGATT
ACCACAAGAGATGCTTCAAAAGCATACATGAAAATGGTAGATAAGTCCTTTTTAGGAAGTTCTGATGAGGTAACCAAGCT
TATGGAAAGGGTCGAGGCAACATTCATTAAGCATTTTTCAAACTCCAATCGCAGTAAGGGGATGAGTGTATTAAGACAAA
AAGCGAAAAACGAGAAACACAGAACAACATTCTCAATGGGTTTTTTATCTGGCTGCACCGTATCTCTAGTAATAGCCCTT
GTTTTGATTATTCGTGCCCGCAATATCATGAGTGAGCCAGGGAGAGAAGCATACATGACAACCATGTTTCCCCTATACAG
TTTGTTTGGGTTCATTGTCCTACACATGCTTATATATGCTGCCAATATATACTTCTGGAGGCGCTATCGAGTTAATTATT
CCTTCATATTTGGTTTCAAACAAGGAACAGAATTAGGATACCGAGAAGTTCTTCTTTTCAGTTTTGGGATAGCAGTACTA
GCACTGATGTCTGTACTAGCAAATCTTGACATGGAGATGGACCCTGAAACTAAAGATTACAAGCCATTTACCGAACTTCT
CCCTTTGAACCTGGTTATCCTTCTAATTGTCCTATTGCTCTTGCCATTTAACGTTCTGTATCGCTCAGCTCGCTTCTTCT
TGCTCACATGTATCTTTCACTGCATTGCTGCTCCTCTCTACAAGGTTACACTTCAAGATTTCTTCTTGGCAGATCAACTA
ACTAGCCAGGTTCAAGCCATCAGAAGTCTGGAGTTCTATATCTGCTACTACGCTTGGGGAGACTATAAGCTTAGAGAAAA
CACTTGTAAAACAAGTGATGTTTACAACACCTTCTACTTTATTGTTGCGGTGATTCCATATTGGGTTCGTCTTCTTCAGT
GCCTTCGGCGCCTGTTCGAAGAGAAAGATATAATGCAAGCAATTAACGGAGGAAAGTATTTTGTCACAATAGCAGCAGTT
TGCTTGAGGACAGCTTATAGTCTCAACAAAGGAACTAGTTGGAGAGTAGCAGCATGGATTTTCTCAGTCATAGCAGCACT
CTATGGGACATATTGGGATCTTGTTTTTGATTGGGGGCTTCTGCAGCGGCATTCCAAGAATCGTTGGCTAAGAGACAAAC
TGCTTGTTCCTCGGAAAAGTGTCTACTTCATAGCCATGGTGTTGAATGTGTTGCTGCGATTTGCTTGGCTACAAACTGTC
TTGAATTTCAACATATCTTCCCTACATGCGGAAACTTCGATTGCCATTGTTGCAAGTCTTGAGATCATTCGCCGTGGCAT
CTGGAATTTCTTCAGGTTGGAAAATGAACACTTGAACAATGTAGGAAAATACCGCGCATTCAAGTCAGTACCACTACCTT
TCAACTATGATGAGGATGATGACAAAGATGAATAG