Details for Castor bean Locus 29813.m001529

Position : 29813 ( 5`- 495380 .. 496849 -3` )
Annotation : [B2G] conserved hypothetical protein [Ricinus communis]
External links : CoGe
PGDD synteny : 29813.m001529

Protein [Map View]
MALRLGMLKAASGNNGYTLGFLRWTHVAAMPPPLDGSINNAIAPPQMVLPEFNPNHDNSNSSYDNNLEFGFLPSFSFGGS
MDLMAVPKKKVSRHKRGIRNGPKALKPTPVIIRCRSCGRVKLPHFYCCSGERGNAGEQNN

DNA
ATGGCGTTGAGGCTAGGGATGCTAAAAGCCGCCAGCGGCAACAACGGTTATACGTTAGGGTTCTTAAGGTGGACCCACGT
GGCAGCCATGCCTCCACCATTGGATGGGTCCATTAACAACGCGATTGCACCTCCACAGATGGTTTTACCCGAGTTCAACC
CGAATCATGACAATAGCAATAGCAGCTATGACAACAACTTAGAGTTTGGGTTTCTTCCTAGTTTCTCTTTCGGTGGATCC
ATGGATTTGATGGCCGTTCCTAAAAAGAAGGTTTCTCGTCATAAGAGAGGCATAAGAAACGGACCAAAGGCTTTGAAACC
AACTCCAGTGATTATTCGTTGCAGGAGTTGTGGTAGAGTTAAGCTGCCACACTTCTACTGTTGCAGTGGAGAAAGGGGGA
ACGCTGGTGAGCAAAATAATTAA