Details for Castor bean Locus 29813.m001524

Position : 29813 ( 5`- 480946 .. 479483 -3` )
Annotation : hypothetical protein
External links : CoGe
PGDD synteny : 29813.m001524

Protein [Map View]
MDAASLAAVRISTTRFSAFPIARRMEDTVNLIQPAWPSTKVEKLALYASRRSLGISFPNQQGGSLNPRHSSLLTRCSTKP
GIDSNNATSRNPAIELDSNTMAQHLATPTSNLAHPPSQFKGLVFDLGPRISWDGTEIGSPVVKRYIGDNEERWFMWYHGR
SDAENSDRIGLAVSSNGIHWARGSEHVRSCADAGMVMDCSKNWWAFDTESVRPSEMVIMSSPMYSSVYWLYYSGFSSEEV
EIPGFSNMCAENPERVHHEHRKHRNHQVGKIFKSLPGLACSQDGRHWARIEGDHHSGALLDVGSPKEWDSLFIAAPQVVV
HGSNDIRMYYYSFDVEKGCFALGLARSRDGIRWVKLGKIMGKGKKGCFDELGVKNACVIRSQKDGKYLMAYEGVAADGTG
SIGLAVSQDGLKNWERVQEDPILETAKGDGWDNKGVKSPCLIQMEDKIDQWRLYYVGVGEQGRTGIGMAISEGSNVQTFR
RCSGLHL

DNA
ATGGATGCAGCTTCACTAGCAGCTGTAAGGATTTCAACTACTCGGTTCTCTGCATTCCCTATTGCCAGAAGAATGGAAGA
CACAGTAAATTTGATCCAACCAGCATGGCCTTCCACCAAAGTGGAAAAGCTTGCTCTATATGCTTCACGCAGATCTCTCG
GCATTAGCTTCCCAAACCAACAAGGAGGTTCATTAAATCCTAGGCACAGTAGTCTCCTTACTCGTTGCTCGACAAAACCA
GGCATTGATAGCAACAATGCTACAAGTAGAAATCCTGCAATTGAATTAGATTCCAATACAATGGCCCAACATCTAGCAAC
TCCAACTTCAAATCTGGCACATCCACCATCACAGTTTAAAGGTTTGGTATTTGACTTAGGTCCCAGAATCTCTTGGGATG
GCACAGAGATTGGATCTCCAGTTGTGAAACGATACATTGGCGACAACGAAGAAAGGTGGTTCATGTGGTATCATGGAAGG
TCAGATGCTGAAAATTCAGACCGCATTGGACTAGCAGTTTCAAGCAACGGAATCCATTGGGCACGTGGATCAGAACATGT
GAGGTCCTGTGCAGATGCTGGTATGGTGATGGATTGCAGCAAGAATTGGTGGGCATTTGATACAGAAAGCGTTAGGCCTT
CAGAGATGGTGATCATGTCCAGCCCGATGTACAGTTCAGTTTATTGGCTTTACTACTCAGGATTTAGTTCTGAAGAAGTG
GAGATTCCAGGTTTTTCAAACATGTGTGCGGAGAACCCAGAAAGAGTTCACCATGAACATAGAAAACACAGAAATCATCA
AGTTGGCAAAATTTTCAAGTCTCTTCCAGGTTTAGCTTGCAGCCAAGATGGTAGGCATTGGGCTAGGATTGAAGGGGATC
ATCATAGTGGGGCTTTGCTTGATGTAGGGTCACCTAAGGAATGGGATTCTTTATTTATTGCTGCACCACAAGTTGTTGTT
CATGGAAGCAATGATATAAGGATGTATTACTACTCTTTTGATGTAGAAAAGGGATGCTTTGCTCTTGGTCTAGCAAGATC
CAGAGATGGGATTAGATGGGTAAAATTGGGGAAGATCATGGGAAAAGGAAAAAAAGGTTGTTTCGATGAACTTGGGGTCA
AGAATGCATGTGTTATAAGAAGTCAGAAAGATGGCAAATACTTAATGGCATATGAAGGTGTAGCTGCTGATGGTACAGGG
AGTATTGGATTGGCAGTATCTCAAGATGGGCTGAAGAACTGGGAGAGAGTTCAAGAAGATCCAATACTTGAAACTGCAAA
AGGGGATGGATGGGACAATAAGGGAGTAAAATCTCCATGCCTGATTCAGATGGAAGATAAAATAGATCAATGGCGGTTGT
ATTATGTTGGTGTTGGTGAACAAGGAAGAACAGGAATTGGAATGGCAATCTCAGAGGGCAGCAACGTCCAGACTTTCAGA
AGATGCTCAGGACTTCATTTGTAA