Details for Castor bean Locus 29729.m002384

Position : 29729 ( 5`- 643186 .. 646272 -3` )
Annotation : protein
External links : CoGe
PGDD synteny : 29729.m002384

Protein [Map View]
MSSRTSPKIRLVRCPKCRHILPELPDVPVYECGGCGTRLQAKIKKENANSTTAGSPETNTRETSKLDYVSEDNKSSSSIQ
AILHSAGECSRNQNNGRYQIESSDCRGDKVTVVNLQNEDEKNAGHQSGSEDFESQQLQDVNLSNDDRKSGSDKKERGVCY
DEQVVRDVYLSREDRSSSSHRSESLTGNVEQLGISNEDCSLNELSNLVSGELAQSPLGGTISEVEINDESSLLALKVEAE
ADHETSHSFTRSSQGELVHTNGSVPFATAHWLEGANISSDILDSSPHEVLEQQPQESSHHRSDRVKSTDTFETTEFFTPS
SELSGTFIDLSKSPTTRSSRAYYDDGVSSYEGTDDQLPDRHKYSCKYAYRLPNNAVSDMRTKRERFPGNSDYGMQHHFRS
SASVLPGKMQYSRKSSNLDRDELLEPTRLNHLVRNWRRAEIDQYPSQHLLHRSGSPSSQLDNGFNDNSSFPSQDKLAYTE
REKMKLLRMVYELQDQLNSSSLSHKENRGVSWKDDRIPMYYDPEVLQQESLHNLYIPRYSGALRDGRNRSQQRKYSRIPF
SDEATTSRHQVDHSFCSCPQDWQRSAQVPSSLLHHNKGFCDIHSRFNLYNSYGSCPSSPQRYIDSEFPTYSRGTKSDDQR
HRDHEVKKYLREKHHLAKRHLRPIAGGVPLITCPCCLKQLQLPADFVLFKRRFHRLKCGACSEVLKFSLVNRTHLIPYTP
TAEPPPPSEVDEYNDATHRRNFTSTSHVSDCPCPDSVSSSDDFTEETSFHAARGNAVQRNVSSSSLDHGKERKRSVLNVS
ESRGKKDVEAYESAGPSTSNYKLKNVSSEIEELPASPRGGGGSPLHRLMGYSSPSALVFGWGPSDPGTSSYHSGHNLT

DNA
ATGAGCAGCAGAACGAGCCCAAAGATTCGATTAGTAAGATGTCCTAAATGTCGGCATATCCTTCCAGAGTTGCCGGATGT
TCCTGTCTACGAGTGTGGTGGCTGCGGCACTCGTCTCCAAGCAAAAATAAAGAAAGAAAATGCCAACAGCACAACAGCAG
GCTCACCTGAAACCAACACTAGAGAGACGAGCAAACTGGATTATGTTTCTGAAGATAACAAATCTAGCAGCTCAATTCAA
GCAATTCTTCATTCTGCAGGAGAATGCTCTCGGAACCAAAACAATGGGAGGTATCAAATTGAATCCAGCGATTGCCGTGG
TGATAAAGTCACAGTTGTGAACTTACAAAATGAGGATGAAAAAAATGCAGGCCATCAAAGTGGATCTGAGGATTTTGAAA
GTCAGCAGCTTCAAGATGTAAACTTGTCGAATGATGACCGAAAGAGTGGAAGTGATAAAAAGGAACGCGGGGTATGTTAT
GATGAGCAAGTCGTGAGAGATGTATACTTATCAAGAGAAGATCGCAGCAGCAGTAGCCATAGAAGTGAATCTTTAACTGG
CAATGTTGAGCAGCTTGGGATTTCCAATGAGGACTGCTCATTAAATGAACTCTCTAATCTTGTGAGTGGAGAGCTGGCCC
AGTCCCCATTAGGAGGAACAATTTCAGAAGTTGAAATTAATGATGAAAGCTCATTATTAGCCTTAAAGGTGGAAGCAGAA
GCAGATCATGAGACTAGTCATAGTTTCACAAGATCAAGCCAAGGAGAGCTGGTTCATACAAATGGAAGTGTCCCATTTGC
CACTGCCCATTGGCTAGAAGGAGCAAACATTTCATCAGATATCCTCGACTCTTCTCCTCATGAAGTTCTAGAGCAGCAGC
CTCAGGAAAGTTCCCACCATCGTTCCGATCGTGTTAAATCTACAGATACATTTGAAACAACAGAATTTTTCACCCCCAGT
TCTGAGCTCAGCGGTACTTTTATAGATTTGTCCAAATCCCCAACAACCAGAAGTTCTCGTGCTTACTACGATGACGGTGT
CTCTTCTTATGAAGGAACTGATGATCAATTGCCTGATAGACATAAATATTCATGTAAATATGCTTATAGGCTTCCAAACA
ATGCTGTTTCTGATATGAGGACCAAGAGGGAAAGATTCCCGGGCAACAGCGATTATGGAATGCAACATCATTTCAGGAGT
TCTGCATCTGTGCTGCCTGGAAAGATGCAGTACTCCAGAAAATCCAGCAATTTGGATCGAGATGAATTGCTGGAGCCGAC
AAGACTCAACCATTTAGTTAGAAACTGGAGAAGAGCAGAGATAGATCAATATCCTTCTCAGCATCTTTTGCATCGAAGTG
GTAGTCCCTCCAGTCAACTGGACAATGGTTTCAATGACAATTCAAGCTTCCCTTCACAAGACAAGCTTGCATATACTGAA
CGGGAGAAGATGAAACTGTTGAGAATGGTTTATGAATTGCAGGATCAACTTAACAGCTCCTCTTTGAGTCATAAAGAGAA
TCGAGGAGTCTCCTGGAAAGATGATCGTATCCCCATGTACTACGATCCTGAGGTCCTACAACAGGAAAGTTTACATAACT
TGTACATTCCTAGATATTCTGGAGCACTCAGAGATGGGAGAAACAGGTCTCAACAGAGGAAATACTCAAGAATACCATTC
TCAGATGAGGCAACAACCAGTAGACACCAAGTTGATCATTCCTTCTGCTCCTGTCCTCAAGATTGGCAGCGCTCAGCACA
AGTACCTTCATCTCTGCTTCATCACAATAAAGGGTTTTGTGACATACATTCTCGCTTCAATCTTTACAATTCCTATGGGT
CTTGTCCCTCAAGTCCTCAACGATATATAGACTCTGAGTTTCCTACATATAGCCGTGGAACCAAGTCTGATGACCAGAGG
CATAGAGATCATGAGGTGAAAAAGTACTTGAGAGAGAAACATCACTTGGCCAAGCGACACCTCAGGCCCATAGCAGGTGG
AGTCCCTCTTATAACTTGTCCTTGCTGCTTGAAACAGCTGCAGTTACCTGCAGATTTTGTCCTCTTTAAAAGGAGGTTCC
ATCGGCTAAAATGTGGAGCTTGTTCAGAGGTTCTCAAGTTTTCACTTGTAAACAGAACTCATCTAATCCCATATACACCA
ACTGCTGAACCCCCTCCACCAAGTGAGGTTGACGAGTATAATGATGCTACTCATCGCAGAAACTTTACTTCAACATCTCA
TGTCAGTGATTGTCCCTGTCCGGATTCTGTGTCATCTTCTGATGATTTCACTGAAGAGACATCATTTCATGCGGCCCGTG
GCAATGCAGTTCAAAGAAATGTTTCTTCCAGTTCACTTGATCATGGCAAAGAGAGGAAGAGATCTGTTCTAAATGTTTCT
GAAAGCAGAGGTAAGAAAGATGTTGAAGCATATGAATCTGCTGGCCCTTCCACTAGTAACTACAAATTGAAGAATGTGTC
CTCAGAAATTGAGGAGCTTCCAGCATCACCAAGAGGAGGGGGAGGTTCACCACTTCATCGACTAATGGGTTATTCTTCAC
CTAGTGCACTGGTGTTTGGCTGGGGACCATCTGACCCAGGGACAAGCTCCTACCATTCAGGACATAACCTGACATAA