Details for Castor bean Locus 29729.m002369

Position : 29729 ( 5`- 563671 .. 564936 -3` )
Annotation : [B2G] wrky transcription
External links : CoGe
PGDD synteny : 29729.m002369

Protein [Map View]
MMGSSSSPDKLSANKERVAKELVQGQEFATQLQILLKKPYGENCFLTTEAHQYELLLKILASFTQALSLVTTCDSVEVCQ
NLAASPADSVCCDDRRSENSGESRRKPTANRRGCYRRKNTSLSWTTVSAAIGDAHTWRKYGQKEILNAKYPRSYFRCIHK
YDRGCKATKQVQKVEEDPQMYCTTYIGHHTCSDILKYPQTITTVSDNNPWEPSYMVIASDSKNIPTGVLDHHHHPTKQEY
KAETPSDLTDNLPSLDSIMWKDFVALESTEAANLRSDYTAASSMEATCQSLDMDFVVKSIDFDNDFRFDESGIF

DNA
ATGATGGGATCGTCTTCTTCGCCTGATAAACTGTCAGCCAACAAGGAAAGGGTAGCGAAAGAGCTTGTTCAAGGCCAAGA
ATTTGCAACCCAACTTCAAATTCTCCTCAAGAAACCGTATGGAGAAAATTGTTTTCTCACAACCGAGGCTCATCAATATG
AGCTTCTACTCAAGATCTTAGCATCTTTCACACAGGCTCTTTCCCTGGTTACTACTTGTGATTCTGTTGAGGTTTGCCAG
AATCTAGCAGCTTCACCAGCGGACTCAGTTTGTTGTGACGACCGGAGGTCTGAAAATTCCGGTGAGAGCAGGAGGAAACC
TACTGCCAACAGGAGGGGTTGTTACAGGAGAAAAAACACTTCCCTGTCATGGACAACAGTCTCTGCTGCAATAGGAGATG
CTCATACATGGAGAAAATATGGGCAAAAGGAGATCCTCAATGCTAAGTACCCAAGGAGTTACTTCAGGTGCATCCACAAG
TACGATCGAGGTTGCAAAGCAACAAAACAAGTCCAGAAAGTGGAAGAAGATCCACAAATGTACTGCACAACTTACATTGG
GCACCACACCTGCAGCGATATTCTCAAGTATCCACAAACTATCACAACAGTTTCTGATAATAATCCTTGGGAACCCAGTT
ACATGGTCATCGCTTCCGATTCAAAGAATATTCCTACTGGTGTACTTGATCATCATCACCATCCAACAAAGCAAGAATAT
AAAGCAGAAACCCCGAGCGATCTAACTGATAATCTTCCATCTCTGGACTCTATCATGTGGAAAGATTTCGTGGCACTCGA
ATCAACTGAGGCAGCGAACCTGCGTTCTGATTATACAGCAGCAAGTTCTATGGAGGCGACTTGTCAGAGTCTGGACATGG
ATTTTGTGGTCAAATCTATTGATTTTGATAATGATTTTCGTTTTGATGAAAGTGGAATTTTTTAA