Details for Castor bean Locus 29729.m002353

Position : 29729 ( 5`- 498993 .. 497225 -3` )
Annotation : [B2G] superoxide dismutase
External links : CoGe
PGDD synteny : 29729.m002353

Protein [Map View]
MQYPITTPVPPKTTNIVPEYTFLEDNYQCQTSALKTLTLPDLPYAYDALEPFISGEIMFLHHQKHHLAYVTNYNKSLELL
NQAIANGDSSSVVKLQSSIKFNGGGHINHSIFWKNLAPVSEGGGIPPHGSLASAIDTEFGSLEKLIQKMNAEGAAVEGSG
WVWLGVDKDSKKLVVATTQNQDPLVTKGPTLVPLLGIDVWEHAYYLQYKNVRPDYLKSIWNVMNWKYASEVYESICPSF

DNA
ATGCAGTACCCCATCACCACACCTGTACCGCCCAAAACAACGAATATAGTACCAGAGTACACATTTCTTGAGGATAATTA
TCAGTGCCAGACTTCTGCATTGAAGACCTTAACTCTCCCTGATCTCCCTTATGCCTATGATGCTCTTGAGCCTTTTATTA
GTGGCGAGATAATGTTTCTTCATCACCAGAAGCATCACCTGGCTTATGTTACTAACTACAATAAGTCTCTTGAGCTTCTC
AATCAGGCTATCGCAAATGGTGACTCTTCCTCTGTTGTCAAGCTGCAAAGTTCTATCAAGTTCAATGGAGGAGGTCATAT
CAACCACTCCATTTTCTGGAAGAATCTTGCACCTGTCAGTGAAGGAGGTGGTATACCCCCACATGGTTCCCTTGCTTCAG
CTATTGACACAGAATTTGGTTCTCTGGAAAAGTTGATACAAAAGATGAATGCAGAAGGTGCTGCTGTGGAAGGATCTGGA
TGGGTGTGGCTTGGCGTGGACAAAGACTCTAAGAAGCTTGTGGTTGCGACCACTCAAAACCAGGATCCATTGGTAACTAA
AGGACCAACTTTAGTTCCTTTGCTTGGTATTGATGTTTGGGAGCATGCTTACTACTTACAGTACAAGAATGTAAGACCAG
ATTACCTAAAGAGCATATGGAATGTGATGAATTGGAAGTATGCAAGTGAAGTATATGAGAGCATATGCCCTTCATTTTGA