Details for Castor bean Locus 29729.m002352

Position : 29729 ( 5`- 491926 .. 490465 -3` )
Annotation : ribosomal protein S26, putative
External links : CoGe
PGDD synteny : 29729.m002352

Protein [Map View]
MTFKRRNGGRNKHGRGHVKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQDSCVYDGYVLPKLYVKMQYCVSCAIH
SRVVRVRSRSERRNREPPQRFLRRRDDLPKPGQPGQPGQGTRPAGAGVAART

DNA
ATGACGTTTAAGCGCAGAAATGGCGGCCGGAACAAGCACGGACGTGGACACGTGAAGTTCATCCGATGCTCGAACTGCGG
AAAATGCTGCCCTAAGGACAAAGCTATTAAGAGATTTCTTGTGAGAAACATTGTTGAACAAGCTGCTGTCAGAGATGTTC
AGGATTCATGTGTTTATGACGGATATGTTCTTCCAAAGCTCTATGTGAAGATGCAGTACTGTGTTTCATGTGCTATTCAC
TCTAGAGTTGTCAGGGTTCGTTCTCGCTCTGAACGTAGGAACCGTGAGCCCCCACAGAGGTTCCTCAGGCGCAGGGATGA
CCTGCCAAAACCTGGACAGCCTGGTCAGCCTGGTCAAGGAACTCGTCCTGCCGGGGCTGGTGTTGCTGCTCGAACCTAA