Details for Castor bean Locus 29729.m002351

Position : 29729 ( 5`- 486742 .. 481278 -3` )
Annotation : [B2G] nucleic acid binding
External links : CoGe
PGDD synteny : 29729.m002351

Protein [Map View]
MGDLHWCLSPCSSSTSSSNSLDLFPLSIDSELWLMAEKRAQEILWILQPSLASEQKRKVVIDYIQRLIKHHFATEVLPFG
SVPLKTYLPDGDIDLTALSHQNMEEDLVREICNILTYEEQNSESEVKDVRYIQAQVKIVKCSVKNISVDISFNQMAGLCA
LCFLEQVDQLIGKDHLLKCSIILIKAWCFYESRILGAHHGLLSTYALEILVLYIINAFHSSLPGPLAVLYRFLEYYSTFD
WDNYCVTINGPVAVSSLPEIMTESPYNNGNELLLCPEFLKRCKEKFSVPIKAVENGGHEFSIKHLNILDPLKDNNNLGRS
VSKGNFHRIKCALSYGAQRLGEILALPGENMGAGLEIFFINTLDRNGRGERPDTLVPVPTFGTGRSEAFDLSGDYDNHYS
GLLQGQWYHKYSLPVSPEMTPPSSPSQIQQSFTWDRLSQLLRCKQNFLSQRGTNVFVPRVPHRHPYAPKVYATASTSDEK
GKSQGTGTYIPNVSHHPRKDMMSWMRSKNPDSLTHSSLNSPRKAEIVEGGPGAKSDNYCCLDLSFDQYKAGQENRENGSC
TVLSLDQFPLLPSLEKSVTSEINQSSHPILQSTHAKEYSTSSRNIPTGTFRHIPFPVALPSSVTGRQTESGVSTTLEIMP
ASSEMGMLKQQKSLD

DNA
ATGGGAGATCTTCACTGGTGTTTGTCACCTTGCTCTTCTTCAACCTCTTCCTCCAATTCACTTGATCTATTCCCATTGTC
AATTGATTCAGAACTCTGGCTAATGGCTGAGAAGAGGGCCCAGGAGATACTTTGGATTCTTCAACCTTCTTTGGCTTCTG
AGCAGAAGAGAAAGGTGGTTATTGATTATATTCAAAGGTTAATTAAGCATCATTTTGCAACTGAGGTCTTGCCATTTGGT
TCTGTACCACTGAAAACGTATCTTCCTGATGGAGATATTGATCTAACTGCACTGAGCCATCAAAACATGGAAGAGGATTT
GGTTAGAGAAATATGCAATATCCTCACATATGAAGAGCAGAATTCTGAGTCTGAAGTTAAAGATGTACGATATATTCAAG
CACAGGTTAAGATTGTGAAATGTTCTGTGAAGAATATATCAGTTGATATCTCTTTCAATCAAATGGCAGGGCTCTGTGCT
CTTTGCTTTCTGGAGCAGGTTGACCAACTTATTGGGAAAGATCATCTTCTCAAATGCAGTATTATTTTGATCAAAGCCTG
GTGCTTTTATGAGAGTCGAATTCTTGGTGCTCACCATGGCTTGCTCTCAACATATGCATTAGAAATACTGGTCTTATATA
TCATAAATGCCTTCCATTCATCGCTACCTGGGCCTTTAGCAGTACTTTATAGATTTTTGGAGTACTATAGCACTTTTGAT
TGGGACAACTACTGTGTCACCATTAATGGTCCTGTTGCAGTGTCTTCCCTTCCAGAAATTATGACAGAGTCGCCGTATAA
TAATGGGAATGAGTTATTGCTCTGCCCAGAGTTTCTGAAGAGATGCAAAGAGAAATTTTCGGTTCCTATAAAAGCAGTTG
AGAATGGAGGGCACGAATTTTCTATTAAGCATCTCAACATATTGGATCCTTTAAAGGACAACAACAACTTGGGGCGTAGT
GTCAGCAAAGGCAATTTCCACCGTATAAAATGTGCTCTTTCTTATGGAGCTCAAAGACTTGGAGAAATCCTTGCGCTACC
AGGAGAAAACATGGGTGCAGGACTGGAAATTTTTTTTATAAATACTTTGGACCGGAATGGGAGGGGAGAAAGGCCAGATA
CACTAGTTCCTGTACCCACCTTTGGCACTGGAAGATCTGAGGCATTTGATCTCAGCGGAGACTATGACAATCACTATAGT
GGTCTACTACAGGGCCAGTGGTACCACAAGTATTCCCTGCCTGTTTCTCCCGAGATGACTCCCCCGTCATCACCTTCTCA
AATCCAGCAAAGCTTTACTTGGGACAGACTGTCCCAATTGCTGAGATGCAAGCAGAATTTTTTGTCTCAAAGAGGTACTA
ATGTATTTGTCCCAAGAGTGCCACATCGTCATCCTTATGCTCCAAAGGTATATGCCACTGCTTCTACTTCTGATGAAAAG
GGGAAGTCACAAGGAACAGGCACATACATTCCTAATGTGAGCCATCATCCTCGCAAAGATATGATGTCATGGATGAGGTC
GAAGAATCCAGATTCTCTAACTCATAGTTCATTAAATTCACCTAGAAAGGCTGAGATAGTTGAAGGTGGCCCAGGAGCAA
AGAGTGATAATTATTGCTGCCTTGATCTGTCGTTTGATCAATACAAAGCAGGACAAGAAAACAGGGAGAACGGCAGCTGC
ACAGTTCTTTCACTGGATCAATTCCCACTTCTTCCCTCCCTTGAAAAGTCGGTGACATCAGAAATCAATCAGTCCAGTCA
TCCCATCTTGCAGTCCACGCATGCCAAGGAATACTCTACCTCCTCAAGAAATATCCCGACTGGAACTTTCAGGCATATTC
CATTCCCAGTGGCACTACCTTCATCAGTGACAGGAAGGCAAACAGAATCTGGAGTTTCTACCACTTTGGAGATCATGCCT
GCTAGCTCGGAAATGGGAATGCTGAAGCAACAAAAATCATTAGACTGA