Details for Castor bean Locus 29729.m002350

Position : 29729 ( 5`- 475264 .. 480588 -3` )
Annotation : [B2G] alpha-galactosidase alpha-n-
External links : CoGe
PGDD synteny : 29729.m002350

Protein [Map View]
MAWLELLKWDGIAGISLLVISMKLSSRKQSYSILWDADDCWSAATRDAKGQLVPDPKTFPSGIKALADYIHGKGLKLGIY
SDAGIFTCQVRPGSLHHEEDDADLFASWGVDYLKYDNCFNLGIKPKERYPPMRDALNASGRTIFYSLCEWGVDDPALWAG
KVGNSWRTTDDINDSWVSMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGMTYQEYRAHFSIWALMKAPLLIGCDVRNMT
AETYEILTNKEVIAVNQDSLGVQGRKVQASGTDGCLQVWAGPLSGHRMAVVLWNRCSKAATITARWDALGLESGTSVAVR
DLWQHKDITGDSVASFGTRVDAHDCAMYTFTPKTVLPAES

DNA
ATGGCTTGGCTCGAACTCCTCAAATGGGATGGAATAGCTGGAATTTCTTTGCTTGTAATATCAATGAAACTGTCATCAAG
GAAACAGTCTTATTCCATTTTATGGGATGCAGATGATTGCTGGTCTGCAGCAACGAGAGACGCGAAGGGTCAATTAGTCC
CTGATCCTAAAACCTTTCCATCAGGAATCAAAGCTCTTGCTGATTATATACATGGGAAAGGCCTCAAGCTTGGTATCTAT
TCTGATGCTGGGATTTTTACATGTCAAGTTCGACCAGGGTCACTTCACCACGAAGAAGATGATGCTGATCTGTTTGCTTC
TTGGGGCGTGGATTATCTAAAGTACGACAACTGTTTTAATCTCGGTATCAAACCAAAAGAAAGGTACCCACCAATGCGTG
ATGCTCTAAATGCATCTGGTCGTACAATTTTCTATTCACTTTGTGAATGGGGTGTTGACGACCCTGCTCTGTGGGCTGGA
AAAGTTGGTAATAGCTGGCGCACAACAGATGACATTAATGATTCATGGGTAAGCATGACCACCATAGCTGATCTGAATGA
TAAATGGGCAGCCTATGCAGGACCTGGTGGATGGAACGATCCGGATATGTTGGAAGTTGGCAATGGAGGCATGACCTACC
AGGAGTATCGTGCTCATTTCAGCATCTGGGCTCTGATGAAGGCCCCACTTTTGATTGGTTGTGATGTAAGAAACATGACA
GCAGAAACTTATGAGATTCTAACAAATAAGGAAGTCATTGCTGTAAACCAAGACTCGCTTGGGGTTCAGGGAAGGAAAGT
TCAAGCTTCTGGAACAGATGGTTGCCTACAGGTCTGGGCAGGCCCTTTGTCTGGACATCGCATGGCTGTTGTTCTCTGGA
ATCGTTGTTCAAAAGCTGCAACTATTACAGCTAGATGGGATGCACTTGGGCTCGAATCTGGCACCAGTGTCGCAGTGCGA
GACCTGTGGCAGCACAAAGACATTACAGGAGACTCTGTGGCATCATTTGGTACGCGAGTTGATGCACATGATTGCGCAAT
GTATACCTTTACTCCGAAGACGGTTTTGCCTGCTGAAAGTTAG