Details for Cucumber Locus 16961415

Position : sca999 ( 5`- 453775 .. 456874 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16961415

Protein [Map View]
MEPIVKGNPTVLSSSSSSSLILTSGASGRINALLSMRALKSLIMLVNAFVLLLLFPFRGPKRGQSVADKPRDDKSERKCP
TVRVPATIVSWKSSSSNNSNSNSTNSLSPTVAVAVDQEVAVRRALAIRRVVEDKDKSEDSIREFLLFQSPRGNTIFTQSW
TPVSLKIRGLVVLLHGLNEHSGRYSDFAKQLNANGYKVFGMDWIGHGGSDGLHAYVHSLDDAVFDLKSYLQKVLADNPGL
PCFLFGHSTGGAMVLKAVLDPSIGSCISGVVLTSPAVGVQPSHSIYAVLAPIVSLLLPTLQVGSANKTTLPVTRDPDALI
AKYSDPLVYTGAIRVRTGYEILKISSYLQQNLSKISVPFLVLHGTADEVTDPTASQKLYKEASSTDKSIKLLEGFLHDLL
FEPERQSIMKDIIDWMNNRL*

DNA
ATGGAGCCAATTGTGAAAGGGAATCCCACGGTGTTATCGTCCTCATCCTCGTCGTCGCTAATTCTAACCTCCGGTGCCAG
CGGTCGCATAAACGCATTGCTGTCGATGCGAGCATTGAAGAGTTTAATCATGTTGGTCAATGCCTTCGTTTTGTTGCTAC
TATTCCCTTTCCGTGGCCCGAAGCGTGGGCAATCGGTGGCGGATAAGCCAAGAGATGATAAGTCAGAAAGGAAATGCCCG
ACGGTGCGGGTTCCGGCGACAATCGTCTCTTGGAAGAGTAGTAGTAGTAATAACAGCAATAGTAATAGTACCAACTCCTT
GTCGCCGACGGTGGCAGTGGCGGTGGATCAGGAGGTGGCGGTGAGACGAGCTCTGGCAATAAGGAGGGTGGTTGAGGATA
AGGATAAAAGTGAGGATTCAATAAGAGAGTTTCTTCTCTTTCAATCCCCAAGAGGAAATACGATCTTTACTCAATCGTGG
ACGCCTGTGTCCCTTAAGATAAGGGGACTGGTGGTTCTCTTGCATGGACTAAATGAACACAGTGGTAGATACAGTGATTT
TGCCAAGCAATTAAATGCAAATGGCTATAAGGTTTTTGGCATGGATTGGATTGGTCATGGTGGGAGTGACGGATTGCATG
CTTATGTTCATTCTCTTGATGATGCTGTTTTTGATTTGAAATCATATCTTCAGAAGGTTTTGGCTGATAACCCGGGCTTG
CCTTGTTTCTTGTTTGGACATTCCACAGGAGGAGCCATGGTTCTCAAGGCGGTGCTCGACCCTAGTATTGGATCTTGCAT
ATCAGGAGTGGTTCTTACATCACCAGCAGTTGGAGTTCAACCATCTCACTCCATCTATGCAGTCCTTGCTCCCATAGTTT
CATTATTGTTGCCAACACTCCAAGTTGGTTCTGCAAACAAGACAACCCTTCCAGTGACTCGAGACCCGGATGCATTGATA
GCCAAATATTCAGATCCTCTAGTCTACACAGGAGCCATCCGCGTAAGAACCGGTTACGAAATTCTCAAGATCTCTTCATA
CCTGCAGCAGAATTTGAGCAAAATAAGTGTTCCATTCCTTGTTCTACACGGCACTGCAGACGAAGTAACTGATCCAACAG
CCTCCCAAAAACTTTACAAAGAAGCATCCTCAACCGACAAATCCATCAAATTGCTTGAAGGTTTCCTACATGATCTCCTA
TTTGAACCAGAAAGACAGAGTATTATGAAAGACATAATTGACTGGATGAACAATAGATTGTAA