Details for Cucumber Locus 16961408

Position : sca999 ( 5`- 424145 .. 423183 -3` )
Annotation : [B2G] unknown [Populus trichocarpa x Populus deltoides]
External links : CoGe
PGDD synteny : 16961408

Protein [Map View]
MALVRDRRHLNLRLPDLSDCRPRFPLPLPPSSAPPAPAAPSAISSSDLDKLQVLGHGNGGTVYKVRHKRTSATYALKVVH
GDCDPTVRRQVFREMEILRRTDSPYVVQCHGIFEKPSGDVTILMEYMDLGSLDSLLKKNSTLSEATLAHVSRQVLNGLHY
LHSHKIIHRDIKPSNLLVNKNMEVKIADFGVSKIMCRTLDACNSYVGTCAYMSPERFDPETYGGNYNGYAGDIWSLGLTL
LELYLGHFPFLPAGQRPDWATLMCAICFGEPPKLPEDASEEFRSFVECCLQKESSKRWTAAQLLTHPFVCRESSRSSDNR
*

DNA
ATGGCTTTGGTCCGTGATCGCCGCCACCTCAACCTCCGTCTCCCCGATCTCTCCGACTGTCGTCCTCGCTTCCCCCTTCC
CCTCCCTCCTTCCTCTGCTCCCCCTGCTCCTGCTGCTCCCTCCGCCATCTCCTCCTCCGACCTCGACAAGCTCCAAGTCC
TCGGTCACGGTAACGGCGGCACCGTCTACAAAGTCCGTCATAAACGCACCTCCGCTACTTACGCACTCAAGGTCGTCCAC
GGCGACTGCGACCCCACCGTTCGTCGCCAAGTTTTCAGAGAGATGGAGATTCTTCGTCGGACTGATTCTCCTTATGTTGT
TCAGTGTCATGGAATCTTTGAGAAACCTTCTGGAGATGTAACGATTTTGATGGAGTATATGGATCTTGGATCTCTTGATT
CGTTATTGAAGAAGAACTCGACTTTGTCTGAAGCGACGCTGGCTCATGTATCGCGTCAGGTTCTTAATGGTCTTCATTAT
CTTCACTCTCATAAAATCATTCATCGTGATATTAAACCGTCGAATCTGTTGGTGAATAAGAATATGGAGGTTAAGATTGC
CGATTTTGGAGTTAGTAAAATTATGTGCAGGACTTTGGATGCTTGCAATTCTTACGTCGGAACTTGTGCTTATATGAGTC
CAGAGCGGTTCGATCCCGAGACGTACGGCGGAAATTACAACGGTTATGCCGGAGATATTTGGAGTTTAGGCCTTACTCTT
CTAGAACTTTACTTAGGTCATTTCCCGTTTCTTCCGGCCGGACAGAGACCGGATTGGGCGACTCTGATGTGTGCGATTTG
CTTCGGTGAACCACCGAAGCTGCCAGAGGATGCATCGGAGGAGTTTCGGAGCTTTGTTGAGTGTTGTTTGCAGAAGGAAT
CGAGTAAAAGATGGACGGCGGCACAATTGTTGACGCATCCGTTTGTATGCAGGGAATCATCGAGATCATCGGATAATCGA
TGA