Details for Cucumber Locus 16961386

Position : sca999 ( 5`- 344508 .. 341497 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16961386

Protein [Map View]
MMSAVSSGDLRLMEDAVADIDQAVAESGDPHAQSVLGLLYGMGIMKETNKAKAFMYHHFAAEGNKQSKMALAYIYFRQEM
YEKAVKLYAELAEVAINSLLVSKDSPVIEPVRIHNGAEENKQALRKSRGEEDEDFQILEYQAQKGNAGAMYRIGLFYYFG
LRGLRRDHAKALSWFSKAVEKGEPKSMELLGEIYARGAGVERDYTKALQWLTRASKQPSFTAYNGMGYLYVKGYGVEKNY
TKAKEYFEKAAENDESGGHYNLGVMYLKGIGVKRDVKKACTHFIMAANAGQPKAFYQLAKMFHTGVGLKRNIPMASALYK
LVAERGPWSSLSRWALESYLKSDIGKAFFLYARMAELGYEVAQSNAAWILDKYGEQSMCLGESGFCTDAERHQRAHSLWW
QASEQGNEHAALLIGDAYYYGRGTDVDYDRAAEAYMHAKSQLNAQAMFNLGYMHEHGLGLPFDLHLAKRYYDQALELDPA
ARLPVKLALVSLWLRMNHADSFLVHVIDSLPEVYPKIDAWVEDVLLEEGNATILTLFACLLTVLYLRERQRRHAAVRAAE
AVPLHPNDHVPPQN*

DNA
ATGATGTCTGCGGTTAGCTCTGGTGACCTGAGGTTGATGGAAGATGCGGTAGCGGATATTGATCAAGCTGTTGCGGAGAG
TGGGGATCCGCACGCGCAATCGGTTCTAGGGTTGTTGTATGGAATGGGAATAATGAAGGAAACCAATAAGGCTAAGGCAT
TTATGTATCATCATTTTGCTGCTGAAGGGAATAAGCAATCTAAGATGGCTCTTGCTTATATTTACTTCAGGCAAGAAATG
TATGAGAAAGCAGTCAAGCTTTATGCTGAATTAGCGGAGGTAGCTATTAATAGTTTATTAGTTTCCAAGGATTCTCCAGT
AATTGAACCTGTGAGGATCCATAATGGAGCTGAGGAGAACAAGCAGGCCTTGAGAAAGTCTCGCGGAGAAGAGGATGAGG
ACTTCCAAATTTTGGAATATCAGGCGCAGAAGGGTAATGCTGGAGCTATGTATAGAATTGGGCTATTTTACTACTTTGGA
CTTAGAGGCTTGAGGCGTGATCATGCTAAAGCATTGTCCTGGTTTTCCAAGGCCGTGGAGAAAGGTGAACCAAAGTCTAT
GGAATTACTTGGAGAGATATATGCAAGGGGGGCAGGAGTCGAAAGGGATTACACCAAGGCACTTCAATGGCTAACTCGTG
CATCTAAGCAGCCGTCATTTACTGCCTATAATGGCATGGGATATTTATACGTTAAGGGTTATGGAGTGGAGAAAAACTAT
ACCAAGGCCAAGGAATACTTTGAGAAAGCTGCCGAAAACGACGAGTCTGGTGGTCATTATAATCTAGGAGTTATGTATCT
TAAAGGCATTGGAGTAAAGAGAGATGTGAAGAAGGCATGTACTCATTTTATAATGGCTGCAAATGCTGGACAACCAAAGG
CATTCTACCAGCTGGCAAAGATGTTTCATACGGGTGTTGGGCTCAAGAGAAATATTCCAATGGCTAGTGCATTGTACAAA
TTAGTTGCTGAACGAGGGCCTTGGAGTTCATTGTCTAGATGGGCATTGGAATCATATCTGAAAAGTGATATTGGCAAGGC
ATTTTTCTTGTACGCAAGAATGGCTGAGCTAGGATATGAGGTCGCACAAAGCAATGCAGCATGGATACTTGACAAATATG
GAGAACAAAGCATGTGTCTTGGAGAATCTGGCTTTTGCACAGATGCAGAAAGACATCAGAGAGCTCATTCTCTATGGTGG
CAAGCTTCCGAGCAGGGCAATGAACATGCTGCTTTACTGATTGGGGATGCATATTACTACGGGCGGGGAACTGACGTAGA
TTATGATCGTGCTGCGGAAGCATACATGCATGCTAAATCCCAACTAAATGCACAAGCCATGTTCAATCTTGGTTACATGC
ATGAACATGGTCTTGGCCTTCCATTTGATCTCCACCTAGCTAAGCGTTACTACGACCAAGCTCTGGAACTTGATCCAGCT
GCCAGGTTGCCTGTCAAGTTGGCCTTAGTAAGCCTTTGGTTAAGAATGAATCATGCTGACAGTTTTCTGGTACATGTGAT
TGATTCATTGCCAGAAGTGTATCCAAAAATTGATGCATGGGTAGAGGATGTACTGTTGGAGGAAGGAAATGCAACAATTC
TAACTCTATTTGCTTGCCTTCTCACTGTGCTATATCTTAGAGAGCGACAACGTAGGCATGCAGCTGTCCGGGCTGCTGAG
GCTGTGCCACTACATCCAAATGACCATGTGCCTCCACAAAATTAA