Details for Lyrate rockcress Locus 16066395

Position : sca3 ( 5`- 671341 .. 672180 -3` )
Annotation : [B2G] 40s ribosomal protein s7
External links : CoGe
PGDD synteny : 16066395

Protein [Map View]
MYSGQNKIHKDKGVEPTEFEEQVTQALFDLENTNQELKSELKDLYINQAVHMDISSNRKAVVIYVPFRLRKAFRKIHLRL
VRELEKKFSGKDVIFVATRRIMRPPKKGSAVQRPRNRTLTSVHEAMLEDVAYPAEIVGKRTRYRLDGTKITKVYLDTKQK
NDTEYKLETMMGVYRKLTGRDVVFEYPVIEA*

DNA
ATGTATTCTGGTCAGAACAAGATCCACAAGGATAAGGGTGTGGAACCAACAGAGTTTGAAGAGCAAGTTACTCAGGCTCT
TTTTGACTTGGAGAACACCAACCAGGAGTTGAAAAGCGAGTTGAAAGATCTCTACATTAACCAAGCAGTTCATATGGATA
TTTCTAGCAACCGCAAAGCTGTTGTCATCTACGTTCCATTCAGACTGAGGAAAGCTTTCCGCAAGATTCATCTCCGCCTT
GTCAGAGAGCTTGAGAAGAAGTTCAGTGGAAAAGATGTTATCTTTGTTGCTACCAGAAGGATCATGCGTCCCCCTAAGAA
AGGCTCTGCTGTTCAGAGACCACGCAACAGAACTCTTACTTCTGTCCATGAAGCCATGCTAGAGGATGTCGCTTACCCTG
CTGAGATTGTAGGAAAGCGAACCAGATACCGTCTTGATGGCACCAAGATCACGAAGGTCTATTTGGACACTAAGCAGAAG
AACGACACTGAGTACAAGCTTGAGACAATGATGGGTGTGTACAGGAAACTTACAGGGAGAGATGTAGTTTTCGAGTACCC
AGTCATAGAAGCTTGA