Details for Lyrate rockcress Locus 16066370

Position : sca3 ( 5`- 8196284 .. 8187971 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16066370

Protein [Map View]
MISRVDYESNDEESDGPELQVVTEEDHLLPKREYFSAAFSLSSLNSRASVFDDEDYDEDEGQEEKHVPVEKSFDPGEREP
VVLLEENHVGYEKEAGILGNKDQMDTGDVQKEELDDLSECNLDEKSVTPLPTLYLDDDGMVILQFSEIFAIQEPRQKRQK
REIRCITYREKYISMDISELVEDDEEVLLKSHGRINTHEKEANQIQLAVPLPIRECSQLVKSGTVRDTSSESREFTTLGR
DSCIMGELVKQDLKDDNSSLCQSQLTMEVFPLDQQEWEHLILWENSPEFSDNLVRASNLDLSRKVCWFSLNVMNSGGQAQ
ADNNMLVPFCVNPLESFGSRGSQSTNESTNKSRHHPQLLRLESERDEDHHSENDDAGWENLKQLNSDALGRLSGFALQDR
DMCDESWLDSIIWESDKDLSRSKLIFDLQDEQMIFEVPNNKERKYLQLHAGSRIVSRSSKSKDGSFQEGCGSNSGWQFNI
SNDKFYRKGKSSQKLQGNAKKSGVHSLRVFHSALAIKLQTMKIKLSNKEKANFHRPKALWYPHDNELAIKQQEKLTTQRS
MKIVVKSLGGKGSLLHVGREESVSSLKAKASRKLDYKETEAMRMFYMGKELEDEKSLAEQNVQPNSLVHLLRTKVHLWPW
AQKLPDENRSLRPPGAFKKKSDLSNQDGHVFLMEYCEERPLILSNAGMGANLCTYYQKSSPEDQHGNLLRNQSDTLGSVI
ILEHGDKSPFLGEIHGGCSQSSVETNMYKAPVFPHRLQSTDYLLVRSAKGKLSLRRIDKIVAVGQQEPRMEIMSPASKNL
HTYLVNRLVAYVYQEFKLRDRIAADELSFLFSNVSDATVRKNMKVCADLERDENGKPCWSKKRNFDKILLGLNTLVAPED
VCSYESMLAGLFRLKQLGITWFTLPASISTALARLPDEAIAAASHVERELQITPWNLSSSFVTCTTQGRENIERLEITGV
GDPSERGLGFSYIQVARKASAASEHMKKKVAACRGVPTVTGTDADPRRLSMEAAREVLLKFNVPDEIIAKQTRRHRTAMI
RKLSSEQAASGGKVDPTRIGMFARGQRMSFLQLQQQARERCQEIWDRQRLSLSACDGDGNESENEANSDLDSFVGDLENL
LDVEGAGEGEESYKSMNEKLDGVKGLKMRRWPSQVEKDEENEDEAAEYAELCRLLMQDENHKKKKKMKVVGEGMGSFPPP
RPNVEPVIDKKSIATQPDASFLIVNESTVKDTTNADKATFKAHKDKQVTEIGTPIGQLKKLKILKENQKVFKEKKTARAN
FVCGACGQHGHMKTNKHCPKYRGNTESHSESIYMKKSTGKLSSSDLSGEVWLKPIENQKPAPKSATKISVNEATKVGDST
SKTPGSSDLAAVSDIDSGTKLTSRKLKISSKAKPRASMVESDSPSHSLMPAFSREREESESHNPSVSGQLLPSTETNQAA
SSRNTISVPHPSLSTDKDQAESCRPHRIIWPPTEKEHPQKKLVIKCLKEITDHDSGSLEETPQFESRTTKRMAELADFQR
QQRLRLSDNCLNWGAKEDRIWRKEQDISTERHREGKVRRDYDDITVSKNRSEIAEIRRYKEVIWSERGEEERQKAKQKKN
LQREIIEDYPPRRKERKLSERGQNINSLCVSDFERNGTEYARQPKRRKKGQVGLANILESIVDTLRAKEVSVSYLFLKPV
SKKEAPNYLDIVKRPMDLSTIRDKVRRMEYSDREQFRHDVWQIKFNAHLYNDGRNPVIPPLADELLVKCDRLLLEYRDEL
TEAEKGIVDSSDSLR*

DNA
ATGATATCTCGTGTAGATTATGAGAGCAATGATGAAGAGTCTGATGGGCCTGAACTTCAAGTAGTTACTGAGGAAGATCA
TCTACTACCGAAAAGGGAGTACTTTTCAGCTGCATTTTCTTTGAGTAGCTTAAATTCCAGAGCTTCTGTGTTTGACGACG
AAGATTATGATGAGGATGAAGGACAAGAGGAGAAACACGTGCCAGTTGAAAAATCTTTTGATCCAGGAGAGAGGGAACCA
GTTGTCTTGTTGGAGGAAAATCACGTGGGGTATGAAAAGGAGGCTGGCATCTTGGGAAATAAGGATCAGATGGACACAGG
AGATGTCCAGAAGGAGGAGCTGGATGACTTATCAGAATGTAATTTGGATGAGAAAAGCGTCACCCCGCTGCCTACGTTGT
ATCTGGATGATGATGGTATGGTCATCTTACAATTCTCTGAGATATTTGCTATTCAAGAGCCACGGCAGAAACGGCAGAAG
AGAGAAATTAGATGTATCACTTATAGAGAAAAATACATATCTATGGATATTTCTGAGCTTGTTGAAGACGATGAGGAGGT
ACTCCTGAAGAGCCATGGTAGGATTAACACTCATGAGAAAGAAGCTAATCAAATTCAGCTGGCTGTTCCCTTACCAATCA
GAGAGTGTTCACAGCTGGTAAAATCTGGCACAGTAAGGGATACTTCATCAGAATCGAGAGAATTTACCACGCTAGGAAGG
GATTCATGTATCATGGGTGAACTGGTGAAGCAGGACTTAAAAGACGATAATTCATCTCTTTGTCAGTCTCAATTAACAAT
GGAAGTTTTCCCTCTTGACCAGCAAGAATGGGAACATCTAATACTCTGGGAAAATTCTCCTGAATTTAGTGATAATCTGG
TAAGGGCTTCAAATCTGGACTTGAGTCGGAAGGTATGCTGGTTCAGCTTAAATGTGATGAACTCTGGAGGGCAAGCTCAA
GCTGACAATAATATGCTCGTGCCTTTTTGTGTAAATCCCTTGGAGTCTTTTGGCTCAAGAGGTTCCCAGTCTACAAATGA
GTCCACTAACAAAAGTAGACATCATCCACAACTCCTAAGATTAGAATCCGAGCGGGATGAAGATCATCATAGTGAAAATG
ACGATGCTGGATGGGAGAATTTAAAGCAGCTTAATAGTGACGCTCTTGGGCGCTTGAGTGGATTTGCATTGCAAGATAGG
GATATGTGTGATGAGTCATGGTTAGATAGCATAATATGGGAGTCAGATAAAGATTTGAGCAGGTCTAAACTAATATTTGA
TCTTCAAGATGAGCAAATGATCTTTGAAGTTCCGAATAATAAGGAAAGAAAATATCTTCAACTTCATGCGGGATCTAGGA
TTGTATCTCGATCTTCAAAATCCAAGGATGGATCCTTTCAAGAAGGCTGTGGATCAAATTCTGGGTGGCAATTCAATATT
TCTAATGACAAATTCTATAGGAAGGGGAAAAGCTCTCAGAAACTGCAAGGAAATGCTAAGAAATCTGGCGTACACAGTTT
GAGAGTTTTTCATTCGGCACTAGCGATTAAATTGCAGACGATGAAGATTAAATTAAGCAATAAAGAGAAAGCAAATTTCC
ACCGGCCCAAAGCTCTGTGGTATCCACATGACAATGAGCTAGCCATCAAGCAGCAAGAAAAGTTAACCACCCAAAGATCC
ATGAAAATTGTAGTTAAGAGTCTGGGGGGTAAAGGATCACTGCTACACGTCGGCAGAGAGGAATCTGTCTCCTCTTTAAA
AGCCAAGGCTTCTAGAAAGCTAGATTATAAGGAAACAGAAGCAATGAGAATGTTTTATATGGGGAAGGAACTTGAGGATG
AAAAGTCTCTTGCTGAACAAAATGTTCAACCCAATTCTCTTGTCCATCTTTTACGTACCAAGGTACATTTGTGGCCATGG
GCACAAAAGCTTCCGGACGAAAATAGATCTTTAAGACCTCCTGGGGCATTCAAGAAGAAATCTGACCTATCTAATCAAGA
TGGCCATGTTTTCTTGATGGAATATTGCGAAGAGAGGCCGTTGATACTCAGCAATGCAGGAATGGGTGCAAATTTGTGCA
CGTATTATCAGAAGTCATCCCCAGAGGATCAACATGGGAACTTGCTGCGCAATCAAAGTGATACCTTAGGGAGTGTGATT
ATTCTAGAACATGGGGACAAATCCCCTTTCCTTGGGGAAATACACGGTGGTTGCAGTCAGTCATCTGTTGAAACAAACAT
GTACAAAGCACCTGTTTTTCCTCATAGGTTGCAATCAACAGATTATTTGTTGGTCCGGTCTGCTAAAGGAAAGCTCTCTC
TAAGGCGTATTGACAAGATAGTTGCTGTTGGACAACAGGAACCTCGAATGGAAATAATGTCTCCTGCATCAAAGAATCTA
CATACTTATTTGGTGAACAGATTGGTGGCCTATGTGTATCAAGAGTTTAAGCTTCGAGACCGTATTGCTGCCGATGAGCT
GTCTTTCTTATTTTCTAACGTCTCAGATGCAACTGTCAGGAAAAACATGAAAGTTTGTGCCGATTTAGAGAGAGATGAAA
ATGGCAAGCCTTGCTGGTCCAAGAAACGTAATTTTGACAAGATTCTACTTGGGTTGAACACTCTGGTGGCACCAGAGGAT
GTGTGTTCCTATGAGAGTATGCTAGCTGGGCTGTTCCGGCTCAAACAATTAGGGATCACCTGGTTTACATTGCCTGCCAG
CATATCAACCGCATTGGCTCGGCTCCCAGATGAAGCGATTGCCGCTGCATCACATGTTGAGAGGGAGTTGCAGATTACTC
CATGGAATCTGAGCAGTAGTTTTGTTACTTGTACAACTCAGGGCAGAGAAAATATAGAACGTTTGGAAATTACTGGAGTT
GGTGATCCCTCTGAACGGGGTCTAGGATTCAGCTACATCCAAGTTGCACGAAAAGCATCAGCTGCATCCGAACATATGAA
GAAAAAGGTAGCAGCCTGTCGCGGAGTCCCAACTGTCACTGGTACAGATGCTGATCCTCGCAGATTAAGCATGGAAGCAG
CTCGAGAGGTTCTTCTCAAGTTCAATGTTCCTGATGAGATAATTGCTAAGCAAACTCGACGGCATCGTACAGCTATGATA
CGCAAGCTATCAAGTGAGCAGGCTGCATCTGGTGGTAAGGTTGACCCCACAAGAATAGGTATGTTTGCACGTGGCCAGAG
AATGTCTTTCCTACAGTTGCAACAGCAGGCCAGAGAAAGGTGTCAGGAGATTTGGGATAGGCAACGTCTGTCCCTTTCAG
CTTGTGATGGTGATGGGAACGAAAGTGAAAATGAGGCAAACAGTGACTTGGACTCCTTTGTTGGAGATCTGGAAAATCTA
CTTGATGTTGAGGGTGCTGGGGAGGGGGAAGAATCTTATAAGTCTATGAATGAAAAGTTGGATGGAGTGAAGGGCCTCAA
GATGAGACGGTGGCCATCTCAAGTTGAGAAAGACGAAGAAAATGAAGATGAAGCTGCTGAATATGCCGAGTTATGCCGAT
TGCTGATGCAAGATGAGAATCACAAGAAGAAAAAGAAGATGAAAGTTGTGGGAGAGGGAATGGGATCCTTTCCTCCTCCA
CGGCCCAATGTTGAACCTGTCATTGACAAGAAATCTATTGCCACCCAACCTGATGCATCTTTCTTAATCGTGAATGAGAG
CACCGTCAAAGACACCACAAACGCTGATAAAGCTACTTTTAAGGCCCACAAAGATAAACAGGTAACAGAGATCGGCACTC
CTATAGGCCAGCTGAAGAAGCTCAAAATACTGAAGGAAAACCAAAAGGTATTCAAGGAAAAAAAAACAGCAAGAGCGAAC
TTCGTCTGTGGAGCCTGTGGTCAGCATGGACACATGAAAACCAATAAACACTGCCCAAAATACAGAGGAAATACAGAATC
ACATTCGGAAAGTATATATATGAAGAAGTCTACTGGAAAACTGAGTTCTTCAGATCTATCAGGCGAGGTCTGGCTGAAAC
CTATCGAGAACCAGAAGCCTGCGCCAAAAAGTGCTACAAAAATTTCTGTAAATGAAGCTACGAAAGTAGGTGATTCAACT
TCCAAAACTCCAGGAAGTTCTGACCTAGCAGCTGTGTCTGATATAGACTCTGGGACTAAGTTGACGTCTAGGAAACTCAA
GATTTCAAGTAAGGCAAAACCTAGAGCATCAATGGTTGAATCTGACAGTCCTTCCCATTCATTGATGCCTGCATTTAGCA
GAGAGAGAGAGGAGAGCGAGTCTCACAATCCTTCTGTTTCTGGACAACTCTTACCTAGTACAGAGACAAATCAGGCTGCC
TCAAGTAGGAACACTATTTCAGTTCCGCATCCATCGTTAAGCACGGATAAAGATCAAGCTGAATCTTGTAGGCCTCATCG
CATTATATGGCCGCCAACAGAAAAAGAACATCCGCAGAAGAAACTTGTTATTAAATGTTTAAAAGAGATAACTGATCATG
ACAGCGGTAGTCTTGAAGAGACTCCACAGTTTGAGTCCAGGACAACAAAAAGAATGGCAGAACTGGCAGATTTTCAGAGG
CAGCAGAGACTCAGATTGTCAGATAACTGTCTAAACTGGGGAGCAAAAGAGGATAGAATATGGCGGAAAGAACAAGATAT
AAGTACGGAAAGGCACAGGGAGGGAAAGGTGAGAAGAGATTATGATGATATTACTGTATCAAAAAATCGCAGTGAGATAG
CTGAGATCAGAAGATACAAAGAGGTTATATGGAGTGAGAGGGGGGAAGAGGAACGACAAAAAGCCAAGCAGAAAAAGAAC
CTGCAACGCGAAATAATAGAAGATTATCCTCCTCGAAGAAAAGAAAGAAAATTGTCAGAAAGAGGTCAGAACATCAACAG
CCTGTGTGTATCTGACTTTGAAAGGAACGGGACAGAGTATGCACGTCAACCAAAACGACGAAAAAAAGGACAGGTTGGCC
TAGCAAACATCTTGGAAAGCATAGTGGACACACTGAGAGCCAAAGAGGTAAGCGTGTCATACCTCTTCTTGAAACCAGTT
TCGAAAAAGGAGGCTCCCAACTATCTTGACATTGTGAAACGCCCAATGGATCTCTCGACAATCCGGGATAAGGTACGGAG
GATGGAGTACAGTGACAGAGAGCAATTTAGACACGATGTCTGGCAGATCAAGTTTAATGCTCATCTTTACAATGACGGGC
GTAACCCGGTAATACCGCCTTTAGCAGATGAGTTGCTGGTAAAATGTGATCGCTTGTTGCTAGAATATAGAGATGAGTTA
ACAGAAGCAGAGAAAGGTATAGTAGATTCCAGTGACTCATTGAGATAG