Details for Lyrate rockcress Locus 16066351

Position : sca3 ( 5`- 10833896 .. 10836529 -3` )
Annotation : [B2G] rnr2 rnr2a
External links : CoGe
PGDD synteny : 16066351

Protein [Map View]
MGSLKESQRRDMDEDESKEPLLMAQNQRFTMFPIRYKSIWEMYKKAEASFWTAEEVDLSTDVQQWEALTDSEKHFISHVL
AFFAASDGIVLENLAARFLNDVQVPEARAFYGFQIAMENIHSEMYSLLLETFLKDSKEKDRLFNAIETIPCISKKAKWCL
DWIQSPMSFAVRLVAFACVEGIFFSGSFCAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLLYSLLQKQLPLEKVYQI
VHEAVEIETEFVCKALPCDLIGMNSNLMSQYIQFVADRLLVTLGCERRYKAENPFDWMEFISLQGKTNFFEKRVGEYQKA
SVMSNLQNGSKNYEFTTEEDF*

DNA
ATGGGTTCGTTGAAGGAAAGTCAAAGAAGAGACATGGACGAAGATGAATCAAAGGAGCCGCTTTTGATGGCACAGAACCA
GAGATTCACTATGTTCCCCATTAGGTACAAATCGATTTGGGAGATGTATAAGAAGGCTGAAGCCAGTTTTTGGACTGCTG
AAGAGGTTGATCTTTCCACTGATGTGCAACAATGGGAAGCTTTGACGGATTCTGAGAAACATTTTATCAGCCATGTTCTG
GCTTTTTTCGCAGCGTCAGATGGTATTGTATTGGAGAATTTGGCTGCTAGATTCTTGAATGATGTCCAAGTTCCAGAGGC
TCGTGCTTTCTATGGGTTTCAAATAGCCATGGAGAACATTCATTCGGAGATGTACAGCTTACTTCTGGAGACATTCTTAA
AGGACTCGAAGGAGAAGGATAGATTGTTCAATGCTATCGAAACCATTCCTTGTATCTCCAAGAAGGCAAAATGGTGTTTA
GATTGGATTCAAAGTCCTATGTCATTTGCTGTGAGGTTGGTTGCTTTTGCATGCGTCGAAGGAATCTTCTTCTCAGGAAG
TTTCTGTGCCATCTTCTGGCTTAAGAAGAGGGGTCTTATGCCGGGTTTGACCTTCTCAAACGAGCTTATATCGAGAGACG
AGGGGCTCCACTGTGACTTTGCGTGTCTCTTGTACAGTTTGCTGCAGAAGCAGCTTCCGTTGGAGAAAGTTTATCAGATT
GTTCACGAGGCAGTGGAAATTGAGACAGAGTTTGTCTGCAAGGCACTTCCATGTGATCTGATCGGAATGAACTCAAACCT
CATGAGTCAATACATACAATTTGTCGCTGACCGTCTTCTGGTTACCTTGGGATGTGAAAGGAGATACAAAGCAGAAAATC
CATTTGACTGGATGGAGTTCATTTCTCTGCAAGGAAAGACAAACTTCTTTGAGAAGAGAGTTGGAGAGTATCAGAAGGCA
TCCGTTATGTCGAACCTCCAAAATGGAAGCAAGAACTACGAATTCACGACTGAAGAGGACTTCTGA