Details for Lyrate rockcress Locus 16066344

Position : sca3 ( 5`- 3273793 .. 3276332 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478119 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16066344

Protein [Map View]
MQSDNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKHNIDGRLVEAKKA
VPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDSEE
AVEKVLLKTFHELNGKMVEVKRAVPKELSPGPSRSPLGAGYSYGVNRVNNILNGYAQGFNPAAVGGYGLRMDGRFSPVGA
GRSGFANFSSGYGMNVNFEQGLPTGFTGGTNFNGNVDYGRGMSPYYIGNTNRFGPAVGYEGGNGGGNSSFFSSVTRNLWG
NNGGLNYNNNTTNSNSNTYMGGSSSVNNTLSGPFGNSGVNWGAPGGGNNAVSNENVKFGYGGNGESGFGLGTGGYAARNP
GANKAAPSSSFSSASATNNTGYDTAGLAEFYGNGAVYSDPTWRSPTPETEGPASFSYGIGGGGPSSDVSARSSSPGYVGS
YSVNKRQPNRGEPSR*

DNA
ATGCAATCGGATAATGGAAAGCTTTTCATCGGTGGGATATCTTGGGACACCAATGAGGAACGTCTCAAGGAGTATTTCAG
CAGTTTTGGAGAAGTGATCGAGGCTGTCATCTTGAAAGATCGCACCACTGGTCGTGCTCGTGGTTTCGGTTTTGTTGTCT
TTGCTGATCCTGCTGTTGCTGAGATTGTTATCACCGAAAAACATAATATTGATGGGAGATTGGTTGAAGCCAAGAAAGCT
GTTCCCAGAGATGACCAAAACATGGTAAATAGAAGCAACAGCAGCAGCATCCAAGGTTCTCCCGGGGGTCCAGGTCGCAC
AAGGAAGATATTTGTTGGAGGATTACCTTCCTCTGTTACAGAGAGCGATTTCAAGACGTATTTTGAGCAGTTTGGAACAA
CTACCGATGTGGTTGTTATGTATGATCACAACACACAAAGGCCTAGAGGTTTCGGATTTATAACCTACGATTCTGAGGAG
GCCGTTGAAAAGGTATTGCTCAAGACATTCCATGAACTAAATGGTAAAATGGTTGAGGTAAAGCGAGCTGTTCCAAAGGA
GTTATCTCCAGGTCCAAGTCGCAGTCCTCTTGGTGCAGGTTACAGCTATGGAGTTAATAGGGTTAATAACATTCTTAATG
GATATGCTCAAGGGTTTAATCCCGCTGCAGTTGGAGGCTACGGACTTAGGATGGATGGTCGGTTCAGTCCTGTTGGTGCT
GGAAGAAGCGGGTTTGCAAATTTCAGTTCTGGCTACGGGATGAATGTGAACTTTGAGCAGGGATTGCCCACAGGGTTCAC
GGGAGGTACTAATTTCAATGGAAATGTTGACTATGGCCGAGGAATGAGCCCGTACTACATTGGTAACACAAACAGGTTTG
GTCCTGCGGTTGGCTATGAAGGGGGCAATGGAGGAGGAAACTCATCCTTCTTCAGTTCGGTTACACGAAACCTATGGGGA
AACAACGGGGGTCTTAACTATAACAACAACACTACAAACTCAAATTCCAATACATACATGGGAGGATCATCAAGTGTGAA
CAACACACTTAGTGGTCCATTTGGAAATTCTGGAGTCAATTGGGGTGCTCCTGGAGGAGGAAACAATGCTGTTAGTAACG
AGAATGTGAAGTTTGGTTATGGAGGAAACGGTGAATCTGGTTTTGGGTTGGGAACAGGTGGTTATGCAGCAAGAAACCCA
GGGGCTAACAAGGCAGCACCATCGTCTTCATTCTCTTCTGCCTCGGCAACCAACAACACGGGTTACGATACAGCAGGACT
TGCAGAGTTTTACGGGAATGGTGCAGTTTATAGTGATCCCACATGGAGATCACCAACTCCTGAGACAGAAGGGCCTGCTT
CTTTTAGCTATGGGATTGGAGGAGGAGGTCCTTCTTCAGATGTTTCAGCTAGAAGTTCATCTCCAGGTTATGTTGGCAGT
TACAGTGTGAACAAGAGACAACCAAACAGAGGCGAGCCATCACGGTGA