Details for Lyrate rockcress Locus 16066343

Position : sca3 ( 5`- 8844676 .. 8843083 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479545 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16066343

Protein [Map View]
MDFLRVRKFRKSRKPNLEKEKEDKILAQQEQARSDNTEAGVIDSAKTDEIEDDDDDFITNEVKRRLKELRRNSFMVLIPE
EEEEEEEEESYLDEDDDDGEDKCSSEWRDVVAEGLQWWGGFDAVYEKYCERMLFFDRLSSQQLKETGIGIAPSPSTPSPR
SASKKLSSPFRCLSLKKLDVPEEDIEHLQPTEIDPYQDLETAYVAQLCLTWEALHCQYTQLSHLISCQPETPTCYNHTAQ
LFQQFLVLLQRYIENEPFEQGSRSELYARARNAMPKLLQAPKIQGSDKKEMEKDTGFMVLADDLIQIIESSILTFNVFLK
MDKKKPNGGIHLFGNHNNNHLNSITPLLLVQSSIDKKRVKAKELSKKTKGLRKKSWPQTWEGVQLLFAAIDIKLATRVLR
MSRISKEQLLWCEEKMKKLNFSAGKLQRHPSPILFPC*

DNA
ATGGATTTCTTGAGAGTTAGAAAATTTCGAAAGTCACGGAAGCCAAACCTTGAAAAGGAGAAAGAAGACAAGATTTTGGC
TCAGCAAGAGCAGGCAAGGAGTGATAACACTGAAGCTGGTGTGATAGATTCGGCTAAAACAGATGAGATCGAAGATGACG
ATGATGATTTCATTACCAATGAGGTTAAGAGAAGGCTCAAGGAGTTGAGGAGAAACAGTTTCATGGTGTTGATACCTGAG
GAAGAAGAAGAAGAAGAAGAAGAGGAATCGTATCTAGACGAAGATGATGACGACGGAGAAGACAAGTGTTCAAGTGAGTG
GAGAGATGTGGTCGCTGAAGGACTTCAATGGTGGGGAGGTTTTGATGCGGTCTATGAAAAGTATTGTGAGCGAATGCTCT
TCTTTGATCGCTTAAGCTCTCAGCAGCTCAAGGAAACTGGCATTGGAATTGCTCCAAGTCCTTCAACTCCATCGCCAAGA
TCTGCATCTAAAAAGCTGTCATCGCCATTTCGATGTCTATCTCTCAAGAAGTTGGATGTTCCCGAGGAAGATATCGAGCA
TTTGCAGCCGACGGAAATTGACCCTTATCAAGATCTGGAGACGGCCTATGTTGCTCAACTCTGCCTCACTTGGGAGGCAC
TTCACTGTCAATACACGCAGCTGAGCCACTTAATCTCATGCCAACCCGAAACCCCGACTTGTTACAACCATACTGCCCAA
CTGTTTCAGCAATTCCTAGTCTTGTTGCAGAGGTATATAGAGAATGAACCATTTGAACAAGGCTCAAGATCTGAACTTTA
TGCACGTGCTAGAAATGCAATGCCTAAGCTACTTCAAGCTCCTAAGATTCAAGGGTCAGATAAAAAGGAGATGGAGAAAG
ATACAGGTTTCATGGTCCTCGCTGATGATCTCATCCAAATCATCGAGAGCTCGATCCTTACTTTCAACGTTTTCTTGAAA
ATGGACAAGAAGAAACCAAATGGGGGTATTCACTTGTTTGGGAACCACAACAACAACCATTTAAATTCTATAACTCCTTT
ACTACTGGTTCAGTCATCCATTGATAAGAAGAGAGTGAAAGCGAAGGAGCTTTCAAAGAAGACAAAAGGGCTGAGAAAGA
AATCATGGCCTCAAACATGGGAAGGTGTTCAACTCTTGTTTGCAGCCATTGACATCAAACTCGCAACACGGGTATTGAGG
ATGTCGAGAATCAGTAAAGAGCAACTTCTATGGTGTGAAGAAAAGATGAAAAAGCTCAACTTTTCAGCTGGGAAGCTTCA
AAGACACCCATCTCCAATTCTTTTCCCATGTTGA