Details for Lyrate rockcress Locus 16066330

Position : sca3 ( 5`- 10041245 .. 10042279 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16066330

Protein [Map View]
MVGNNNNNAKSSTNKPPATSAPTAAVSSSQNHKPRLNSTNNDGGTSNNNKKESKPTTGGQKIADKKLPKPNFSPKLAPIP
KQSNQNHPNPSAPSSSRPMAPFPFPDSSAALGPPPPPTYGFHMLERRTIVLADGSVRSYFALPPNYQDFPPQSRLAGPEF
GRFPPFYPEEFRDQRMKRKYPGEEEIDRRDERAEMLRQRQHFMQYANPNDQSLMAGTSSSPFLRDVGEDGRAAKHMRIGS
SRHDNGGLLVDQIALKKSFLSFVKRVFEDPTEKKNYLENGRKGRLQCLVCGRFDGFQSDFCVCFLIQFSLLVLETLVALF
LMVSLIGLICLRTLNEHEESKREH*

DNA
ATGGTCGGGAACAACAACAACAACGCCAAGTCATCGACGAACAAGCCTCCGGCAACTTCCGCTCCCACCGCTGCAGTTTC
CTCTTCACAGAACCATAAACCTCGTTTGAATTCGACTAACAACGATGGTGGAACCAGTAACAACAACAAAAAAGAAAGCA
AACCGACGACAGGTGGCCAGAAAATCGCCGATAAGAAACTTCCGAAGCCTAATTTTTCTCCTAAGCTAGCTCCGATTCCG
AAACAATCCAATCAGAATCATCCAAATCCATCAGCTCCATCATCTTCACGGCCAATGGCTCCGTTTCCTTTCCCTGATTC
ATCTGCGGCGCTAGGTCCTCCTCCTCCACCGACGTATGGATTCCATATGCTTGAGCGGCGCACAATTGTTCTCGCTGATG
GTAGTGTCCGTTCCTACTTCGCTCTTCCTCCTAATTACCAGGATTTTCCTCCTCAGAGTCGACTAGCTGGACCGGAATTT
GGTAGATTCCCTCCCTTTTACCCGGAAGAGTTTCGAGATCAGCGGATGAAACGGAAATATCCGGGTGAAGAAGAGATTGA
TAGGAGAGACGAGAGAGCTGAGATGCTGAGACAAAGACAGCATTTTATGCAGTATGCGAATCCTAATGATCAATCACTTA
TGGCTGGTACGAGTAGTAGTCCGTTTCTTAGGGATGTTGGAGAAGATGGTAGAGCAGCTAAGCATATGCGGATAGGATCA
AGTAGGCATGACAATGGAGGTCTATTGGTTGACCAGATTGCACTAAAGAAATCGTTTTTGAGTTTTGTTAAGCGAGTTTT
CGAGGATCCGACAGAGAAGAAGAACTACTTGGAGAATGGGAGAAAAGGGCGGCTTCAGTGTCTCGTTTGTGGCAGGTTTG
ATGGGTTTCAATCTGACTTTTGTGTTTGTTTTTTGATTCAGTTTAGTTTGCTTGTGTTGGAGACTCTAGTTGCCTTGTTC
TTGATGGTTTCTTTAATTGGTCTTATATGTCTTAGAACGCTAAATGAACATGAAGAAAGTAAGAGAGAACACTAA