Details for Lyrate rockcress Locus 16066328

Position : sca3 ( 5`- 3287461 .. 3288245 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16066328

Protein [Map View]
MESGDYDVETKREKLKSVLSHLLADPILADVPRNPTLSDVVTLVSLEKGSAMRLSVVKLDGSSLDVAVMNSATLKDLKLL
IKKKVNETEQANMGHRHISWKHVWSNFCLSCNNEKLLDDNALLQDVGIRNNSQVTFMPYVMKKGRGRHSKRKKHRLFRSL
HKTSS*

DNA
ATGGAGAGCGGCGATTACGACGTTGAGACGAAAAGAGAGAAGCTTAAATCGGTTCTCTCTCATCTCCTCGCCGATCCGAT
TCTCGCCGACGTTCCGAGGAATCCAACACTCTCTGATGTCGTCACTCTTGTCAGTCTTGAAAAGGGAAGCGCTATGCGTC
TCTCCGTCGTCAAGCTCGACGGCTCCTCCCTGGATGTGGCGGTCATGAATTCAGCTACTTTGAAAGATCTGAAGCTTTTG
ATCAAGAAGAAAGTTAACGAAACGGAGCAAGCAAACATGGGTCATCGCCACATTTCTTGGAAACATGTATGGTCAAACTT
CTGTCTTTCGTGTAATAATGAGAAGTTGCTTGATGATAATGCTCTTCTTCAAGATGTCGGAATCCGGAACAATTCTCAGG
TGACCTTCATGCCATATGTGATGAAGAAGGGTCGAGGAAGACACTCAAAGAGGAAGAAGCATCGTCTCTTTCGTTCACTC
CACAAGACTTCTTCTTGA