Details for Lyrate rockcress Locus 16066322

Position : sca2 ( 5`- 16538161 .. 16536175 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16066322

Protein [Map View]
MLEAAKNNSSILNGGGGGGGFSQLQSCFGDCSSEEELSVLPRHTKVIVTGNNRTKSVLVGLQGVVKKAVGLGGWHWLVLT
NGIEVKLQRNALSVLEHPTGNEEDNDLEVDHTTQWNNPSDMTTEDTLKPHKSKQRGHRSSRLSQKALCRAVSCDSHSKNS
SITPRMNMKVDLTKLDMAALLRYWRHFNLVDALPNPTKEQLIDIIQRHFMSQQMDELQVIVGFVQAATGMKKACQVEAKR
SQKH*

DNA
ATGCTGGAAGCTGCGAAGAACAACTCAAGCATCCTCAATGGAGGAGGAGGAGGAGGAGGATTCTCTCAGCTACAAAGTTG
CTTCGGCGATTGCAGTAGCGAAGAAGAATTATCTGTGTTGCCACGTCATACCAAAGTCATCGTTACCGGAAACAACCGTA
CCAAATCCGTACTCGTCGGTCTTCAAGGCGTCGTTAAAAAAGCCGTCGGACTCGGTGGTTGGCATTGGCTGGTTTTGACT
AATGGAATTGAAGTGAAGTTGCAGAGGAATGCGCTTAGTGTTCTTGAACATCCTACAGGGAACGAAGAAGACAATGATCT
TGAAGTCGACCATACTACACAGTGGAATAATCCTTCCGATATGACAACTGAGGACACTTTGAAGCCTCATAAGTCGAAGC
AGAGAGGACACAGATCATCGCGGTTATCTCAAAAGGCTTTGTGCAGGGCAGTTTCTTGTGACTCACACTCAAAAAACTCG
AGTATTACTCCTCGCATGAACATGAAGGTTGATCTTACCAAGTTGGATATGGCTGCATTACTGAGATATTGGCGACATTT
TAACCTCGTGGATGCTCTTCCAAATCCAACAAAGGAGCAACTGATTGACATTATTCAGAGACACTTCATGTCTCAGCAAA
TGGATGAGCTTCAGGTTATCGTGGGATTCGTTCAGGCTGCAACAGGAATGAAGAAGGCTTGCCAAGTGGAAGCCAAAAGA
AGCCAGAAACACTGA