Details for Lyrate rockcress Locus 16066319

Position : sca2 ( 5`- 16452349 .. 16451666 -3` )
Annotation : [B2G] cupin family protein
External links : CoGe
PGDD synteny : 16066319

Protein [Map View]
MAHISQISSFLSRVLIFLALCITLFTNPTLALPALKLNPLQEFCVADLQATPTNSGFPCKSQVTSEDFFYSGLNTPLNTS
NPKGIAANPANLLTFPGLNTLGISMYNVAIAPGGYNQPHSHPGATEAGVVIEGWVLVGFLTTNNTLYSKVIGPGDMFVIP
PGLIHYEGNVGKTQCRLLTVVADDLPSEVGVPHTLFATKPAIPEAVLMAAFKADSKTIDMLRSKFTT*

DNA
ATGGCTCATATTTCACAAATCTCTTCTTTTCTCTCAAGAGTTTTAATCTTCCTTGCATTATGCATCACTCTCTTCACGAA
CCCTACTCTCGCACTCCCAGCCCTAAAACTTAACCCTTTACAAGAATTTTGTGTAGCTGATCTCCAAGCTACACCAACCA
ACAGTGGCTTCCCCTGCAAGTCACAAGTCACCTCTGAAGACTTTTTTTATTCCGGCTTGAACACTCCTTTAAACACGTCG
AACCCAAAAGGTATTGCCGCTAATCCAGCCAATCTCTTGACCTTCCCGGGCCTAAACACTTTGGGAATATCCATGTACAA
CGTTGCAATTGCACCTGGAGGATACAACCAACCTCACTCTCACCCCGGTGCGACCGAGGCAGGGGTCGTGATCGAAGGTT
GGGTCTTGGTTGGGTTCTTGACGACTAACAACACGTTGTACTCGAAGGTTATTGGACCTGGTGATATGTTTGTGATTCCT
CCGGGACTCATTCATTACGAGGGGAACGTTGGGAAAACGCAATGCCGTCTTTTGACGGTTGTTGCTGACGACTTGCCTAG
CGAGGTTGGTGTGCCTCACACTCTGTTTGCTACGAAACCCGCGATTCCAGAAGCAGTATTGATGGCGGCGTTCAAGGCGG
ATAGTAAAACAATCGACATGCTCAGGTCAAAGTTTACTACTTAA