Details for Lyrate rockcress Locus 16066301

Position : sca2 ( 5`- 16515745 .. 16517332 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_476640 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16066301

Protein [Map View]
MEVCGDLNSDNLKNRPLTPLRILRGLMILLVFLSTAFMFLLYFAPIAALGLRLLSVHQSRKVISLIFGHWLALWPYLFET
VNGTTVVFSGDIIPVEKRVLLIANHRTEVDWMYLWNIALRKRCLGYIKYVLKSSLMKLPIFGWGFHVLEFIPVERKREVD
EPVLLQMLSSFKDPQEPLWLALFPEGTDFTEEKCKRSQKFAAEVGLPALSNVLLPKTRGFGVCLEVLHNSLDAVYDLTIA
YKPRCPSFMDNVFGTDPSEVHIHVRRVLLKEIPANEAESSAWLMDSFQLKDKLLSDFNAQGQFPSQRPEEELSVLKCIAT
FAGVISLTVLFIYLTLYSHSCFKVYACLSGTYLTFATYYKFRPSPGCFREDSCKQVKNH*

DNA
ATGGAAGTTTGCGGGGATCTGAATTCTGATAACTTAAAGAACCGCCCCTTGACTCCGCTTAGGATTCTGAGGGGCTTGAT
GATTCTACTGGTGTTTCTCTCTACTGCTTTTATGTTCCTGCTGTACTTTGCACCAATAGCTGCTCTAGGTCTACGGCTTC
TGAGTGTGCATCAATCTAGAAAAGTTATATCGTTAATCTTTGGTCACTGGTTAGCTTTGTGGCCTTACCTGTTTGAAACG
GTTAATGGGACAACCGTGGTGTTCTCTGGAGACATCATTCCGGTTGAGAAACGTGTTTTGCTTATTGCAAATCACAGGAC
AGAGGTGGATTGGATGTATTTGTGGAATATTGCCTTGAGAAAACGGTGTCTTGGTTACATCAAATACGTGCTCAAGAGCA
GCTTGATGAAATTACCTATTTTTGGCTGGGGTTTCCATGTTTTGGAGTTTATACCAGTGGAGAGGAAGCGGGAGGTCGAC
GAGCCTGTTTTGCTTCAAATGCTTTCATCGTTTAAGGATCCTCAAGAACCCTTATGGCTTGCTCTATTCCCGGAAGGAAC
CGATTTCACTGAAGAGAAATGCAAGAGAAGCCAAAAGTTTGCAGCTGAAGTTGGTCTTCCAGCACTATCAAACGTTCTTC
TACCAAAAACAAGGGGTTTTGGCGTTTGCTTAGAAGTTCTTCATAACTCTTTGGATGCAGTATATGATTTGACTATCGCA
TATAAACCTCGCTGCCCATCTTTCATGGACAATGTATTCGGGACGGATCCTTCAGAAGTTCATATCCACGTTCGGCGAGT
TCTTCTAAAGGAGATTCCAGCAAACGAGGCAGAATCTTCTGCTTGGTTAATGGATTCATTTCAGTTGAAGGACAAACTGC
TATCCGATTTCAATGCTCAGGGGCAGTTCCCAAGTCAAAGACCAGAAGAAGAACTCTCTGTTCTGAAGTGCATCGCAACA
TTTGCAGGGGTAATATCTTTGACAGTACTATTCATTTATCTAACCTTGTATTCACATAGCTGTTTCAAAGTATATGCTTG
TCTAAGCGGCACATATTTAACTTTTGCTACATATTACAAGTTCCGACCCTCACCTGGCTGTTTTAGAGAAGATTCTTGTA
AACAAGTTAAAAACCATTAA