Details for Lyrate rockcress Locus 16066263

Position : sca3 ( 5`- 2856528 .. 2857242 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16066263

Protein [Map View]
MSNISPIFTISNSQHFSDYGFDPQLHYFQVMEEARKHKRETSSKSYMNGLQFKIQKPISKDNPTRSTMHNDKKKKRCWWK
KALPFFKWRKWPISTVGVNEDRRARNFRAVAGSMSMSGPIYATESLSGSSTPYRTTTTNRPSSGPIARTLTPARKGDVAN
PYLSLRELNMDQPQRISISSSPIYLVT*

DNA
ATGTCCAACATTTCCCCAATCTTCACCATCTCCAACTCTCAACATTTCAGCGACTATGGCTTCGATCCCCAGCTCCACTA
CTTTCAGGTTATGGAAGAAGCGAGGAAGCATAAGAGAGAAACGTCATCAAAATCATACATGAACGGTCTTCAATTCAAGA
TCCAGAAACCCATTTCAAAAGACAACCCGACCCGGTCCACAATGCACAACGACAAGAAGAAGAAACGGTGTTGGTGGAAG
AAAGCTTTGCCTTTCTTCAAATGGCGGAAATGGCCAATCTCCACCGTCGGCGTGAACGAAGATCGTAGGGCTAGAAATTT
TCGCGCCGTAGCCGGGTCGATGTCGATGTCGGGTCCAATTTACGCAACGGAGAGTCTGAGCGGGTCGAGCACACCGTACC
GTACGACGACGACAAATAGACCTTCGTCGGGACCTATAGCGAGAACATTGACGCCGGCGAGGAAAGGTGACGTGGCGAAC
CCATATCTGAGCTTACGAGAGCTAAACATGGACCAGCCACAGAGGATTTCTATCTCTTCTTCGCCCATTTACTTGGTCAC
GTAA