Details for Lyrate rockcress Locus 16066233

Position : sca3 ( 5`- 3186889 .. 3188899 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478080 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16066233

Protein [Map View]
MAASANPSGNNQEGSSATQKVSSSSAAATNGAAVNSVDNGGNAGVGALRHNPGISTDWTHEEQSLLEDLLVKYATEPSVF
RYAKIAMKMKDKTVRDVALRCRWMTKKENGKRRKEDHSSRKSKDKKQEKATDSSAKSSSHLNVHPNGPSYAPPMMPIDTD
DGISYKAIGGVSGDLLEQNAQMFNQVSSNFSAFQLHENVNILCKARDNILAILNDLNDMPEVMKQMPPLPVKVNEELANS
ILPRPSHQRKS*

DNA
ATGGCGGCGAGCGCGAACCCGTCGGGGAACAATCAGGAAGGTTCGTCGGCTACACAGAAGGTATCGTCTTCTTCAGCGGC
GGCTACGAATGGCGCAGCTGTGAATTCGGTCGATAATGGTGGCAACGCAGGCGTTGGCGCGTTGAGGCATAATCCTGGGA
TCTCTACCGATTGGACTCATGAGGAACAATCTCTATTGGAAGATTTGCTCGTCAAGTACGCGACAGAACCTTCGGTTTTT
CGATATGCGAAGATTGCGATGAAAATGAAGGATAAGACTGTTCGAGATGTTGCGCTGCGCTGTCGATGGATGACTAAAAA
GGAAAACGGAAAGCGTAGGAAAGAAGACCATTCGTCGAGGAAAAGCAAAGATAAGAAACAGGAAAAAGCTACAGATTCTT
CAGCCAAGTCCTCATCTCATTTGAATGTGCATCCTAATGGTCCTTCTTACGCTCCGCCTATGATGCCTATCGATACTGAT
GATGGTATTTCGTATAAAGCTATTGGTGGTGTGAGTGGAGATCTTCTCGAGCAAAATGCTCAAATGTTCAATCAAGTTTC
ATCAAATTTCTCAGCCTTCCAGCTACATGAGAATGTCAATATCTTGTGCAAAGCTCGGGACAATATCCTCGCAATCTTGA
ACGACTTGAATGACATGCCAGAAGTTATGAAGCAGATGCCACCTCTTCCGGTGAAGGTGAATGAGGAGCTGGCAAATTCG
ATTCTCCCTCGCCCATCCCATCAAAGGAAGTCATGA