Details for Lyrate rockcress Locus 16066200

Position : sca3 ( 5`- 1080893 .. 1082269 -3` )
Annotation : [B2G] phototropic-responsive nph3 family protein
External links : CoGe
PGDD synteny : 16066200

Protein [Map View]
MDINPSIFHLVTRFCYGYKIDLSADNIVSVLCIAYYLDMSDDHSSNNLLNKAVTFLEQRVLMSCNETVKALRICSDKILD
KLADVGLIEVFLDSLVEKALNDTRLLQDLITLPLRLYEPLILELSKHNVSIEKFVASVCNYAKRWVFEKDDGSVSRNKRE
VIEAVEKLLPHERGIISCGFLFKSLKESIFLDACSDCRKGFEVRISNQLDMARAKDLLILSPTEDGSYDIELLKTILKSF
YSNYSVSDLSRFVSVARMLEEFLLEAAASDADLRVGTFKELAEIAVAASCDVLSYSDGIYRAIDAFLERHRDLIESEKME
ACRFLECKKLSPEACEHASKNEKLPLRIVMQVLFVSQMQIRDKVAREMKGVVEEKTQDQVHEDDEVESMSKKLLKLEIEP
DYSKKRKIDNLECVVYCEKKKTSVWREVKRKFGCMTSSTMDACNCHFKKRKKTYHLYK*

DNA
ATGGACATCAACCCGAGTATCTTCCACCTCGTGACTAGATTCTGCTATGGCTACAAAATCGATTTATCAGCTGACAACAT
CGTCTCTGTGCTATGCATTGCTTATTACCTAGATATGAGCGATGATCATAGCTCTAACAACTTGTTGAACAAGGCAGTAA
CTTTCTTGGAACAACGAGTTCTCATGAGCTGTAATGAAACCGTGAAAGCTCTTCGTATCTGCAGCGATAAGATTCTGGAC
AAACTAGCTGATGTTGGACTCATCGAAGTTTTCTTAGATTCTCTTGTCGAAAAGGCTCTCAACGATACTAGGTTGCTCCA
AGATTTGATTACATTACCACTTCGGTTATATGAACCCTTGATTCTAGAGTTGAGTAAGCACAATGTCTCGATAGAAAAAT
TTGTAGCATCGGTCTGCAATTACGCAAAAAGATGGGTTTTCGAGAAAGATGACGGAAGCGTTTCAAGGAACAAGAGAGAA
GTAATTGAAGCTGTTGAGAAGCTTTTGCCTCACGAAAGAGGAATAATCTCGTGTGGATTTCTGTTCAAATCTCTGAAAGA
ATCGATTTTTCTTGATGCTTGCTCTGATTGCCGAAAAGGGTTTGAAGTTAGGATCAGTAACCAGCTCGACATGGCTAGAG
CAAAAGATCTCCTGATTCTATCACCAACAGAAGATGGATCTTATGACATCGAGCTCTTGAAAACCATTCTCAAGAGCTTC
TATAGTAACTATAGTGTCTCGGATCTTTCGCGGTTTGTGAGTGTAGCGAGAATGTTGGAAGAGTTTCTGTTGGAGGCTGC
TGCGAGTGATGCTGATTTAAGGGTAGGAACATTCAAGGAATTAGCAGAAATAGCGGTTGCTGCGTCTTGTGATGTGCTGA
GTTACTCCGATGGAATATACAGAGCGATTGATGCTTTCTTGGAGAGGCATAGAGATTTGATTGAATCGGAGAAGATGGAA
GCTTGTAGATTTCTTGAATGTAAGAAACTTTCGCCCGAGGCTTGTGAACATGCTTCAAAGAACGAGAAGCTTCCATTGCG
GATTGTTATGCAAGTTTTATTTGTTTCTCAGATGCAGATTCGCGATAAGGTGGCTAGAGAAATGAAAGGTGTAGTAGAGG
AGAAAACACAGGATCAGGTACATGAAGATGATGAAGTGGAGAGTATGAGTAAGAAGTTGTTAAAGCTCGAGATAGAACCT
GACTATAGCAAGAAAAGAAAGATTGATAATCTTGAATGTGTTGTTTATTGCGAGAAGAAGAAGACAAGTGTGTGGAGAGA
AGTAAAGAGGAAGTTTGGTTGTATGACTTCTTCTACCATGGATGCTTGCAATTGTCATTTCAAGAAGAGGAAGAAGACTT
ACCATCTCTACAAATAA