Details for Lyrate rockcress Locus 16066066

Position : sca1 ( 5`- 7742326 .. 7744093 -3` )
Annotation : [B2G] peptidyl-trna hydrolase family protein
External links : CoGe
PGDD synteny : 16066066

Protein [Map View]
MKSVAFPAKIANLSFPSGCSSLFFSPALPCRKLTKGTRGVGGLMSQCLSSSSQSLSSLSNSFSSQPESELLQALPSSKPK
SPPPQLPWLIVGLGNPGKKYQGTRHNVGFEMVDALANAEGISMNTVNFKALFGKGVIGNIPIMMAKPQTFMNLSGESVGQ
IVSFYKIPLKQVLVVYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQ
EQEELDYTFQTGIEAIRILLLEGINKSATFVNTRKSMEQLS*

DNA
ATGAAATCTGTAGCTTTTCCCGCTAAAATCGCAAATCTCAGCTTCCCTTCTGGCTGTAGCTCACTGTTTTTTTCGCCGGC
ATTGCCTTGTCGGAAGCTGACAAAAGGAACAAGAGGTGTCGGAGGTTTGATGTCTCAGTGTTTGTCATCATCGTCACAAT
CATTGTCCTCTTTATCGAATTCATTCTCCTCTCAACCGGAATCAGAGTTACTTCAAGCTTTACCCTCTTCGAAGCCAAAA
TCTCCGCCACCGCAGCTGCCATGGCTCATTGTTGGTTTGGGTAATCCCGGCAAGAAGTACCAGGGCACGCGCCACAACGT
TGGTTTTGAGATGGTGGACGCTTTGGCTAATGCAGAAGGCATCTCCATGAACACTGTTAACTTCAAGGCCTTGTTTGGAA
AAGGCGTTATTGGAAATATACCGATTATGATGGCTAAACCACAAACTTTCATGAACCTAAGTGGTGAGTCTGTTGGACAA
ATTGTTTCATTTTACAAGATCCCGCTAAAGCAAGTACTTGTGGTTTACGATGATTTAGATTTGCCCTTTGGTAAACTGCG
TTTATTGCCAAAAGGTGGTCACGGAGGCCACAATGGGATGAGAAGCATTATAGATCGCCTCAAAGGTAGCCGTGATTTTC
CTCGTCTAAGAATAGGGATCGGTCGGCCTCCAGGGAAGATGGATACAGCCAATTTTGTTCTCCGCCAGTTCAATAGACAA
GAACAGGAAGAGTTGGATTATACATTCCAAACCGGGATAGAAGCAATAAGGATTCTTTTGCTTGAGGGGATCAACAAAAG
TGCAACCTTTGTCAACACTCGAAAATCTATGGAGCAACTCAGTTAG