Details for Lyrate rockcress Locus 16065986

Position : sca3 ( 5`- 5110111 .. 5111287 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065986

Protein [Map View]
MSNNNSLITNLFEGRNKGIDASSSDSDDDRAVSTTEQEEDESPKLIPESKPQSEGDKVGDIVRFGKDSYFVIDIFEKEIM
ELGDKVDLNFKRFKRFEAVYGDAPRDHHFYNYHCCYSCCCVCSSSTVGRLWGILETGLASREKEGVSFFVRTYKERKELM
RVVVTVTDCHQNHNLYFFDLKFPREYPYRAPSFYYHPYGLHLSTPEAQKSLKEKSCYNILDVFLHIQEIVLMNTNKSCHQ
MLDILEQPLAGFQDFVKGYFRRKGPLILRNLLQELDMEEERDKKMFWKLYFAFEGNKVYCEQILNSDLKAELEKLKEKEH
TLSDYYYGSSSSPNYPTYTQRDDGIKKTSKIQSFWSKYLSLSFD

DNA
ATGAGTAATAATAATTCTTTGATTACTAATCTCTTCGAAGGTAGGAATAAAGGTATTGATGCAAGCAGCAGCGACTCTGA
TGATGATCGAGCAGTTTCTACTACTGAGCAGGAAGAAGATGAATCCCCAAAACTTATACCGGAGTCTAAACCGCAATCGG
AAGGTGATAAAGTGGGCGACATCGTTCGTTTTGGAAAAGACAGTTACTTCGTTATTGATATTTTCGAGAAAGAGATCATG
GAGTTAGGAGACAAAGTTGATTTAAACTTCAAGAGATTCAAAAGGTTCGAAGCTGTTTATGGAGACGCTCCGCGAGACCA
TCACTTCTACAACTACCATTGCTGTTACTCTTGCTGCTGCGTCTGCTCGAGTAGTACCGTGGGTAGATTGTGGGGGATTC
TAGAGACAGGACTAGCCTCGAGGGAGAAGGAAGGAGTCAGCTTCTTCGTGAGAACTTATAAAGAGAGAAAAGAGCTGATG
AGAGTTGTTGTAACTGTCACAGATTGTCATCAGAATCATAACTTGTACTTCTTCGACCTCAAGTTCCCTAGGGAGTATCC
ATATCGAGCACCGAGTTTCTATTACCATCCCTATGGCCTTCATTTGAGTACTCCTGAAGCCCAAAAGTCATTGAAAGAAA
AGTCCTGCTACAACATCTTAGATGTGTTTCTCCACATTCAAGAGATTGTGTTGATGAACACCAACAAGTCATGTCACCAG
ATGCTAGATATTCTTGAACAGCCGCTCGCGGGGTTTCAAGATTTCGTAAAAGGGTATTTTAGGAGGAAGGGGCCTTTGAT
TCTGCGGAACTTGCTGCAAGAGTTGGATATGGAGGAGGAGAGGGACAAGAAAATGTTCTGGAAGTTGTACTTTGCCTTTG
AAGGCAATAAAGTTTATTGTGAGCAGATTCTGAACAGTGACCTGAAAGCAGAGCTGGAGAAATTGAAGGAGAAAGAACAT
ACATTAAGCGATTACTACTATGGTTCTTCTTCATCTCCCAACTACCCAACCTACACTCAACGGGATGATGGTATTAAGAA
GACATCCAAAATCCAAAGCTTTTGGAGCAAGTACTTGTCTTTGTCTTTCGATT