Details for Lyrate rockcress Locus 16065970

Position : sca3 ( 5`- 9338232 .. 9333971 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_342260 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065970

Protein [Map View]
MHSVRFGIDITDGYPKIIRGETRDIELRSSSSVTPCVLRLRSSSPVFDCSCFMESESENNNDDNLGQEIDREEDGPPPSS
VGGKRTKSQRSSSGFAVKPRKRPAHRAPVWKHFVQQEDNLALSKCRYCGQLIGCDTVKTGTSAMTNHIKRCKLFKMYESD
NQKVLAGDSSGVHRLMPNHQLALELELEIEIDSMVSFCELCGAEADIHCAADSAFLCRSCDAKFHGSNFLFARHFRRVIC
PNCKSLTQDFVSGPLLPWPPRTTCCSESSSSSSSCCSSLDCVSSSELSSTTRGVNRARGRENRVKAKAVAVTVADGIFVN
WCGKLGLKRDLTNAVVSYASLALSVAERKPRATKRVILAAAFWFGVKNTMKLQSLKKVEDVTGVSAGMIRAVESKMARAM
TLQLRRWRVDSEEGWAENDNV*

DNA
ATGCATTCGGTTCGGTTCGGAATAGACATAACCGACGGTTACCCGAAAATTATCCGCGGCGAAACTCGAGATATTGAGCT
TCGATCTTCATCATCCGTTACTCCGTGTGTTCTTCGACTTCGATCTTCATCACCAGTGTTCGATTGTAGTTGTTTTATGG
AGTCGGAATCAGAAAACAACAATGATGACAATCTTGGTCAAGAGATTGATAGAGAAGAAGATGGTCCACCTCCCTCTTCA
GTTGGAGGAAAAAGAACCAAATCTCAGAGATCAAGTTCTGGTTTTGCAGTCAAACCGAGGAAAAGGCCAGCTCATAGAGC
ACCTGTGTGGAAGCATTTCGTTCAGCAAGAAGACAATCTGGCTTTAAGCAAGTGTAGATACTGTGGCCAACTGATTGGGT
GCGACACAGTCAAAACTGGAACAAGTGCTATGACCAATCACATCAAAAGGTGCAAGTTATTCAAGATGTATGAGAGTGAT
AATCAGAAAGTGTTAGCTGGAGATAGCAGTGGTGTTCACAGACTCATGCCCAATCATCAGTTGGCCCTTGAATTGGAGTT
GGAAATTGAGATCGACTCAATGGTGAGCTTCTGCGAGCTTTGTGGTGCCGAAGCTGATATCCACTGCGCCGCGGACTCAG
CTTTCCTCTGCCGTTCTTGTGACGCTAAGTTCCATGGCTCAAATTTCCTCTTCGCTCGTCATTTCCGTCGCGTCATCTGC
CCTAATTGCAAATCTCTCACTCAAGATTTCGTTTCTGGTCCTCTTCTTCCTTGGCCTCCACGAACAACTTGCTGTTCTGA
ATCATCGTCTTCGTCTTCGTCTTGCTGCTCGTCTCTTGATTGTGTCTCAAGCTCCGAGCTATCGTCGACGACGCGTGGCG
TAAACAGAGCGCGAGGGAGGGAAAACAGAGTGAAGGCTAAGGCCGTTGCGGTTACGGTGGCGGATGGCATTTTTGTAAAT
TGGTGTGGTAAATTAGGACTAAAGCGAGATTTAACAAACGCTGTCGTTTCGTATGCGTCACTCGCTTTGTCTGTGGCGGA
GAGGAAGCCGAGAGCGACGAAGAGAGTGATTTTAGCGGCGGCGTTTTGGTTCGGCGTTAAGAACACGATGAAGTTGCAAA
GTTTAAAGAAGGTGGAAGATGTAACCGGAGTTTCAGCTGGGATGATTCGAGCGGTTGAAAGCAAAATGGCGCGTGCAATG
ACGCTACAGCTTAGACGGTGGCGCGTGGATTCGGAGGAAGGATGGGCTGAAAACGACAACGTTTGA