Details for Lyrate rockcress Locus 16065946

Position : sca3 ( 5`- 6168180 .. 6167778 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065946

Protein [Map View]
MDPILPEDSPTSQFTRPLAFQEQYVWEPYDSEKLPETLASEIQRFLRVANLVESEEPRVAYLSHRIDRTSNGRGVRRFKD
SLLRGLEKASHYPRVENGTLITSS*

DNA
ATGGATCCCATCTTACCCGAAGATTCGCCAACCAGCCAGTTCACGAGACCACTCGCTTTTCAGGAACAATATGTGTGGGA
ACCCTACGACAGCGAGAAGCTTCCGGAGACATTAGCCTCAGAGATTCAGAGGTTTCTTCGTGTAGCAAACTTGGTTGAGT
CTGAAGAACCTCGTGTTGCTTATCTGTCTCACCGCATTGACCGTACTTCCAACGGAAGAGGTGTACGGCGGTTCAAAGAT
TCTCTGCTTCGAGGGCTTGAGAAGGCAAGTCACTACCCAAGAGTAGAAAACGGGACACTGATTACCTCTAGCTAG