Details for Lyrate rockcress Locus 16065939

Position : sca3 ( 5`- 6145340 .. 6145933 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065939

Protein [Map View]
MKKDSVRKNKKLVINIALDKEVLASRLEADHDLGSLRDEKERFESSERRRDVVCSKAEDIFDKATNDHSSVRGDGIMREV
DVGTGLSGALNRLREQGTFKEESKIVGVKDNHEDDRFKDRFKDIEIQRVDKWGRILTEKEAYRSLCHRFHGKGPGKKKQE
KQRKKHEDKSKQMESSERAVERIREVHAISKSPYIVL*

DNA
ATGAAGAAGGATTCTGTGAGGAAGAATAAGAAACTCGTTATAAATATTGCTCTAGATAAAGAAGTTCTTGCTTCGCGATT
AGAAGCTGATCATGATCTTGGTTCTCTAAGAGATGAGAAAGAGAGGTTTGAATCATCAGAGAGAAGAAGAGATGTGGTTT
GTTCCAAAGCTGAAGATATTTTTGATAAGGCAACTAATGATCATTCTAGTGTTAGAGGAGATGGGATCATGCGGGAGGTT
GATGTCGGAACAGGATTATCGGGCGCGTTAAACCGTCTGAGAGAGCAAGGAACTTTCAAGGAGGAAAGCAAGATTGTAGG
TGTTAAGGACAATCATGAAGATGACAGATTCAAAGATAGATTTAAGGATATAGAGATTCAGAGGGTGGACAAGTGGGGAA
GGATATTGACTGAGAAGGAAGCGTATCGGTCACTGTGTCATAGATTCCATGGGAAGGGGCCTGGGAAGAAGAAGCAAGAG
AAACAGAGGAAGAAGCATGAAGATAAGTCAAAACAGATGGAATCTTCAGAGAGAGCTGTGGAAAGAATTAGAGAAGTTCA
TGCCATATCCAAGAGTCCTTACATTGTTCTCTAA