Details for Lyrate rockcress Locus 16065932

Position : sca3 ( 5`- 4279918 .. 4277819 -3` )
Annotation : [B2G] ATNAP7 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065932

Protein [Map View]
MAGVNLQLRQAYSIAQFVPTVSSPPPLHTQRVRLGTSPSRVLLCNLRANSAAAPILRTTRRSVTVSASSVSSSVDSDSLV
EERDDMGRIPLLEVRDLRAVIAESRQEILKGVNLVIYEGEVHAVMGKNGSGKSTFSKVLVGHPDYEVTGGSIVFKGQNLL
DMEPEDRSLAGLFMSFQSPVEIPGVSNMDFLNMAFNARKRKLGQPELDPIQFYSHLVSKLEVVNMKTDFLNRNVNEGFSG
GERKRNEILQLAVLGAELAILDEIDSGLDVDALQDVAKAVNGLLTPKNSVLMITHYQRLLDYIKPTLIHIMENGRIIKTG
DNSLAKLLEKEGYKAISG*

DNA
ATGGCCGGCGTTAACCTACAACTCCGTCAAGCATACTCTATAGCTCAATTCGTTCCAACTGTTTCTTCTCCTCCTCCTCT
TCATACTCAGCGAGTTCGGCTCGGGACTTCACCCTCCCGTGTTCTTTTATGCAATCTCCGAGCTAATTCCGCCGCCGCTC
CAATCCTACGAACTACTCGCCGTTCAGTTACTGTTTCGGCGTCTTCCGTATCCTCATCCGTCGATTCGGATTCGTTGGTG
GAAGAACGCGATGACATGGGGAGGATCCCGTTGCTTGAAGTTAGGGATTTGAGAGCTGTGATTGCTGAATCGAGACAGGA
GATACTAAAAGGCGTCAATTTGGTTATCTACGAAGGAGAGGTTCACGCAGTGATGGGGAAGAACGGTTCAGGGAAGAGCA
CATTTTCCAAGGTTCTTGTTGGTCATCCGGATTATGAAGTGACGGGAGGGAGTATTGTGTTTAAAGGGCAGAATCTACTT
GATATGGAACCAGAAGATAGATCTCTTGCCGGTCTTTTTATGAGTTTCCAATCCCCAGTTGAGATCCCTGGTGTTAGCAA
TATGGATTTCTTGAATATGGCCTTTAATGCTCGGAAAAGAAAGCTTGGTCAGCCAGAGCTTGATCCAATCCAGTTCTACA
GCCACTTAGTATCAAAACTTGAAGTTGTGAATATGAAGACCGATTTTCTCAACAGAAATGTCAATGAAGGATTTAGTGGT
GGTGAAAGGAAACGCAATGAGATTCTACAGTTAGCGGTCCTTGGAGCCGAGTTGGCTATACTGGACGAGATTGATTCAGG
GTTAGATGTTGATGCTCTTCAAGATGTGGCAAAGGCAGTGAACGGGCTTTTGACACCAAAAAACTCTGTTCTGATGATAA
CTCACTATCAACGGCTACTTGACTACATCAAACCAACTCTCATACACATCATGGAGAATGGAAGAATCATTAAAACCGGA
GACAACTCCTTGGCCAAACTACTGGAAAAGGAAGGCTACAAAGCGATATCCGGTTAG