Details for Lyrate rockcress Locus 16065928

Position : sca3 ( 5`- 4154624 .. 4155397 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897216 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065928

Protein [Map View]
MKKKKIHQSDDEEDDTFYYRYSSVAAPPPSNPRQPSSSSAKSSAPGGGSGGLAPSKSTLYVSNLDFSLTNSDIHTLFSTF
GKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILNGRKLTVSIAADNGRASEFIKKRVYKDKSRCYECGDE
GHLSYECPKNQLGPRERPPPPKKRGRRKEDEGEAEEIRDWSAAPSLEGFEEENWASVVDNEAGERLRMREAEEEEERRKK
RKEKKVSYFSDESDDED*

DNA
ATGAAGAAGAAGAAGATTCATCAGAGCGACGATGAGGAGGACGACACTTTCTACTATCGCTACTCTTCCGTCGCAGCACC
ACCACCTTCGAACCCTAGACAACCTTCTTCCTCCTCCGCGAAATCATCAGCTCCCGGCGGCGGATCTGGCGGCTTAGCTC
CTTCAAAATCAACACTCTACGTCTCCAATCTCGATTTCTCCCTCACCAATTCCGACATCCACACTCTCTTCTCCACTTTC
GGCAAGGTCGCGAGAGTCACTGTTCTCAAAGATCGCCACACTCGCCAATCCCGTGGCGTCGCGTTCGTGCTCTACGTTTC
TCGTGAAGACGCGGCTAAAGCGGCGCGTTCTATGGACGCGAAGATTCTTAACGGTCGGAAATTGACGGTTTCGATCGCTG
CCGATAATGGACGTGCGTCGGAGTTTATTAAGAAGAGAGTTTACAAGGATAAATCCAGGTGTTACGAGTGTGGAGACGAA
GGGCATCTTTCGTATGAGTGCCCTAAAAATCAGTTAGGTCCAAGGGAGAGACCACCGCCGCCGAAGAAAAGGGGGCGGCG
GAAGGAGGATGAAGGTGAGGCTGAGGAAATTAGGGATTGGTCTGCGGCGCCGTCGTTGGAGGGATTTGAGGAGGAGAATT
GGGCTTCGGTGGTGGACAATGAAGCCGGAGAGAGGTTGAGAATGAGAGAAGCAGAGGAAGAAGAAGAGAGGAGGAAGAAG
AGAAAGGAGAAGAAAGTTAGCTACTTCAGTGATGAGAGTGATGATGAAGATTAG