Details for Lyrate rockcress Locus 16065925

Position : sca3 ( 5`- 5266650 .. 5262950 -3` )
Annotation : [B2G] cbs domain-containing protein
External links : CoGe
PGDD synteny : 16065925

Protein [Map View]
MTGMALELSVLGRSVIDSKTLNLKRYGQKSKLSGRFLPRAELHCPVALSSSKSSNLSFRFRRSCEFSYRSRFMLFSSSQC
HEGSQQNSESGEKELESIKVLLKRGIVLGAVVCGVFLYGCQKVLASAGVMEAGYEVFGQSVVLFKNALPKIYQVLRVLRE
QGLILAALLSLSAFFSMAETSITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATAIF
GEAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLILYPVGRIVTYLSMGILKILGLKGRSEPYVTE
DELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMTPLVDVVAIDASASLVEFHSMWVTHQYSRVPVFEQRIDNIV
GIAYAMDLLDYVQKGDLLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGE
IFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSGFVCEAFGYIPKTGESVKVVLEKES
WEEDGDEEEGKQERQEPKEKNQIYRVEILAGNARKVSAVRFERVNDMDQVSEARDVKSMVPKFVRKWSSEEDDGNLSNDD
QSEDAVLDEHVLADNSKKQQ*

DNA
ATGACGGGTATGGCACTTGAGTTATCTGTTCTGGGTCGATCTGTCATTGACTCTAAAACCTTAAATTTGAAGAGATATGG
TCAAAAATCGAAGCTTTCAGGAAGATTTCTGCCGAGAGCTGAGCTGCACTGCCCTGTGGCGTTGAGTTCTTCTAAAAGCT
CCAATTTGAGTTTTAGATTCAGACGAAGTTGTGAATTTAGCTACAGAAGTCGCTTTATGCTGTTTAGCTCCAGTCAATGT
CACGAAGGTAGTCAACAAAATTCTGAATCTGGCGAAAAGGAGCTGGAGTCGATTAAGGTTTTGCTGAAACGTGGAATTGT
TTTGGGAGCTGTAGTGTGTGGAGTGTTCTTGTATGGATGCCAAAAAGTGTTGGCATCGGCTGGTGTGATGGAAGCAGGCT
ATGAGGTGTTTGGTCAGAGCGTCGTGTTGTTTAAGAATGCTTTGCCGAAAATTTACCAGGTTCTTAGGGTTCTTAGAGAG
CAAGGTCTAATTCTGGCTGCGCTGCTCAGCCTCTCAGCATTCTTCTCTATGGCAGAGACGTCCATTACCACTCTGTGGCC
GTGGAAGGTGCGTGAGTTGGCTGAGAAAGAACCAGAGAATGGTGTATTCAGAATGCTCCGGAGTGATGTTACCAGATTCT
TGACGACTATACTTATTGGAACAACTGTTGTGAATATTGCGGCAACTGCCCTGGTCACCGAAGCAGCAACAGCTATATTT
GGGGAAGCTGGTGTTAGTGCAGCCACTGGATTGATGACAGTGGCTATTTTACTCCTGACTGAGATTACTCCAAAAAGTGT
TGCTGTCCACAATGCTCAAGAAGTTGCAAGGATTGTGGTCAGGCCAGTGGCATGGCTTTCCTTAATATTATATCCTGTCG
GGAGGATTGTCACATATCTGTCAATGGGAATACTGAAAATTCTTGGTTTGAAAGGACGGAGTGAACCATATGTTACTGAA
GATGAGTTGAAACTGATGCTAAGAGGTGCAGAATTAAGTGGTGCCATTGAAGAAGAGGAGCAGGATATGATTGAAAATGT
GTTGGAGATTAAGGATACCCATGTTCGAGAGGTGATGACTCCTCTTGTTGATGTTGTTGCAATTGACGCCAGCGCCAGTC
TAGTCGAGTTCCATAGCATGTGGGTGACCCATCAGTACTCAAGGGTGCCTGTTTTTGAGCAGCGTATTGATAATATCGTG
GGAATTGCATATGCTATGGATCTCCTAGATTATGTTCAGAAGGGTGATCTGCTCGAAAGTACTTCTGTGGGGGACATGGC
ACATAAACCTGCATACTTCGTCCCTGATTCAATGTCTGTTTGGAATCTTCTTAGAGAATTTCGAATAAGAAAGGTTCACA
TGGCAGTTGTCCTTAATGAATATGGTGGAACGATTGGAATAGTAACTCTTGAAGATGTTGTCGAAGAGATTGTTGGTGAA
ATTTTTGATGAAAATGATTCCAAAGAGGAGATTCAGAAGAAAACAGGGTATATTGTCATGAGAGATGAGGGCATATATGA
TGTTGATGCTAATACATCGATTGACCAGCTATCTGAAGAACTGAATATGAAAATGCCAGAGGGCATTCAGTACGAGACAG
TCTCAGGCTTTGTGTGTGAAGCCTTTGGGTATATCCCAAAAACTGGAGAAAGTGTGAAGGTTGTTCTTGAAAAGGAAAGC
TGGGAAGAGGATGGTGACGAGGAGGAAGGGAAACAGGAGAGGCAAGAGCCAAAGGAAAAGAACCAAATCTATAGAGTAGA
GATACTAGCAGGGAATGCAAGAAAAGTTAGTGCTGTCCGGTTTGAAAGAGTGAACGATATGGATCAAGTGTCGGAGGCAA
GGGATGTAAAAAGCATGGTTCCCAAATTCGTAAGGAAATGGAGCAGCGAAGAAGATGATGGGAACTTGTCGAACGACGAC
CAATCCGAGGATGCTGTCTTAGATGAACATGTACTGGCTGATAATAGCAAGAAACAACAATGA