Details for Lyrate rockcress Locus 16065919

Position : sca3 ( 5`- 9723553 .. 9724585 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065919

Protein [Map View]
MYSSSPVSTCFFLIPILAMVATQLVFMRTVSSLNMTNAYLNHKCLAKQGRYKPGSWYEKQLQTIIVSIGSGDGFTHGYDM
MGLGDDSDYVSVTNQCRGDSYGSKCRSCFATAIAGGAIIWYDQCTVEISSFDPQGKFDKDNDFCMSNAKKMNVDSFGEKW
MTFLDNLVGIALKDYLYAAGDTRFGTKKLYGMVQCRTDIYNNSCRKCVGHLAVKFQDCWHGKQGARVMGSGCNFRYELYP
FVSSAKPNLK*

DNA
ATGTACTCTTCATCGCCCGTATCGACATGCTTCTTTTTGATCCCTATCTTGGCCATGGTGGCCACACAACTGGTCTTTAT
GCGCACCGTTTCGTCTTTGAACATGACCAATGCCTATTTGAACCACAAATGCTTAGCCAAACAAGGAAGATACAAGCCGG
GAAGTTGGTATGAGAAACAACTCCAAACTATCATAGTCTCTATCGGAAGCGGTGATGGTTTTACCCACGGTTACGACATG
ATGGGCCTTGGTGATGATTCTGATTACGTCAGCGTCACCAACCAGTGCCGCGGGGACTCCTACGGGTCCAAGTGCCGCTC
CTGCTTTGCCACCGCCATCGCAGGGGGGGCAATAATATGGTATGACCAATGTACTGTCGAGATTTCTTCGTTCGATCCTC
AAGGAAAGTTCGATAAAGATAACGATTTCTGTATGTCCAACGCGAAGAAAATGAACGTAGATTCGTTTGGAGAGAAGTGG
ATGACTTTCCTCGACAATTTGGTGGGTATAGCCCTCAAAGATTATTTGTATGCCGCGGGGGATACAAGGTTCGGGACGAA
GAAGTTGTACGGGATGGTGCAGTGTAGGACTGACATATATAATAATAGTTGTCGAAAGTGTGTTGGACACTTAGCCGTGA
AATTTCAAGATTGCTGGCATGGTAAACAAGGAGCTAGAGTTATGGGTAGTGGTTGTAACTTTAGGTATGAGCTTTACCCT
TTTGTTAGTAGTGCCAAGCCTAATTTGAAGTAA