Details for Lyrate rockcress Locus 16065910

Position : sca3 ( 5`- 4946247 .. 4948805 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065910

Protein [Map View]
MAATMVKDGNLDYSEDEEENFSDDGDWGDWKADDSGVGGGEEEEDDDDSESDFLCLFCDSHFVSCDLLFEHCSLRHGFDF
HRIRNEMKLDFYSSFKLINYIRSQVAENKCWSWKIEADDFNDVKFPWDEEKYLKPVWQEDSLLYSFADDEEDEEDTFDRE
EVMEDLRKLGDLCIDVEALGETSMSNNDKCNINGNKDVTLLSDCNGLKQSSADDLIVNGKDAEPKVCDGRLVNRNIKKVN
ENYFGSYSSFGIHKEMLNDKVRTEAYRDALLKNPTLLSGSVVMDVGCGTGILSLFAAKAGASRVVAVEASEKMAKVASKQ
IAKDNKVFNDNEHNGVLEVAHSMVEELDKSIQIQAHSVDVLVSEWMGYCLLYESMLSSVLYARDRWLKPGGAILPDTATM
FVAGFGKGATSLPFWEDVYGFDMSSIGKEILEDTARLPIVDVIEERDLVTQPALLQTFDLSTMKPDEVDFTATATLKPTE
SEAKTRLCHGVVLWFDTGFTNRFCKENPTVLSTSPYTPPTHWAQTVLTFQEPISVAPASLLSGDDRRGAIGTKECPASSI
HLRMSVARAHEHRSIDISLEATGLSSNGQKRRWPVQIFNL*

DNA
ATGGCGGCGACAATGGTGAAGGACGGGAATCTGGACTACAGCGAAGATGAAGAAGAAAACTTCTCAGACGACGGAGATTG
GGGTGACTGGAAAGCAGATGATAGTGGCGTAGGAGGAGGAGAGGAGGAGGAGGATGACGACGACTCGGAATCTGATTTTC
TGTGTTTGTTTTGTGATTCTCACTTCGTCTCCTGTGATTTACTCTTTGAACACTGTAGTCTGAGGCACGGGTTTGATTTT
CATCGAATTAGAAACGAAATGAAGCTCGATTTCTACTCTTCGTTTAAGCTCATCAACTATATTCGCTCACAGGTGGCGGA
GAACAAATGTTGGAGTTGGAAGATTGAAGCTGATGATTTCAATGATGTTAAGTTTCCTTGGGATGAAGAGAAGTATCTGA
AGCCCGTTTGGCAGGAGGATTCACTTTTGTACTCATTTGCAGATGATGAGGAAGATGAAGAAGACACGTTTGACAGGGAG
GAAGTCATGGAGGATTTGCGGAAACTTGGGGATTTATGCATTGATGTTGAGGCTTTAGGGGAAACCTCAATGTCGAACAA
TGATAAATGCAACATAAATGGAAATAAGGATGTAACTTTGCTCTCAGACTGCAATGGCCTGAAGCAAAGTTCTGCGGATG
ATTTGATAGTCAATGGGAAAGATGCAGAACCAAAGGTTTGTGATGGAAGGCTAGTTAATAGGAACATCAAAAAGGTGAAT
GAAAACTATTTTGGATCTTATAGTTCGTTTGGCATTCACAAGGAGATGCTAAATGATAAGGTTAGAACAGAAGCATACCG
AGATGCACTTTTGAAGAATCCTACTCTCTTGAGTGGCTCTGTTGTAATGGATGTTGGTTGTGGAACTGGGATATTGAGTC
TCTTTGCTGCTAAAGCTGGGGCTTCAAGGGTAGTTGCAGTTGAAGCTAGTGAGAAGATGGCCAAAGTTGCTTCCAAGCAG
ATTGCGAAGGATAACAAAGTATTCAATGATAACGAGCATAATGGTGTTCTTGAAGTTGCACACTCAATGGTTGAAGAGCT
AGATAAATCGATACAGATTCAAGCTCATAGTGTTGATGTGTTAGTCAGCGAATGGATGGGATACTGCCTTTTATATGAGT
CAATGCTCAGTTCTGTGCTCTATGCAAGAGATCGGTGGTTGAAACCTGGAGGTGCAATCCTCCCTGACACGGCAACTATG
TTTGTTGCGGGATTTGGAAAAGGTGCCACAAGTCTTCCTTTCTGGGAAGATGTCTATGGCTTTGACATGTCTTCAATTGG
TAAGGAAATACTTGAAGACACTGCTCGACTTCCCATTGTTGACGTTATAGAGGAGCGTGACTTAGTGACACAGCCTGCCC
TTCTTCAGACATTTGACCTGTCTACCATGAAACCGGATGAAGTAGATTTCACAGCAACCGCAACGCTGAAGCCCACTGAG
TCAGAAGCAAAAACTAGGTTGTGCCACGGTGTTGTGTTGTGGTTCGACACAGGTTTCACCAATAGGTTCTGCAAGGAAAA
CCCAACCGTACTATCCACATCACCCTACACTCCCCCAACACACTGGGCTCAGACAGTCTTAACTTTTCAAGAACCAATCT
CAGTGGCACCTGCCTCGCTTCTGTCTGGTGATGACAGAAGAGGAGCCATTGGAACCAAAGAGTGTCCCGCCTCAAGCATT
CATCTGCGTATGAGTGTTGCACGAGCGCATGAGCATCGCAGCATTGATATCTCGTTAGAGGCTACTGGGCTGAGCTCAAA
CGGTCAGAAGCGTCGCTGGCCGGTTCAGATATTTAATCTATGA