Details for Lyrate rockcress Locus 16065901

Position : sca3 ( 5`- 6271570 .. 6272799 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065901

Protein [Map View]
MDMMKKRKLDENGGGLITNGGGIIGPTRLTPQDARKIIERFTTDQLLDLLQEAIVRHPDVLDSVRSTADSDISQRKLFIR
GLAADTTTEGLLSLFSNYGDLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQGTGSQ
IADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQTALADPVKVIDGKHLNCK
LAVDGKKGGGKPGMPQAQDGGSGHGHVHGDVMGMVRPAGPYGAAGGMSAYGGYSGGPPPHHMNSTPSSMGVGTGGYGGHY
GGYGGPGGTGGYGGLGSGYGGPGGGSGPYRMPPSSMPGGGYPESGHYGLSSSTGYPGQHHQAVGTSPVPRVPHGGMYPNG
PPNY*

DNA
ATGGATATGATGAAGAAGCGAAAGCTCGATGAGAACGGTGGAGGACTCATTACCAACGGTGGCGGAATCATTGGTCCTAC
TCGATTGACGCCACAAGACGCGAGGAAGATTATCGAGCGATTCACCACTGATCAGCTGCTCGACTTATTGCAAGAGGCTA
TCGTACGCCATCCCGACGTGCTTGACTCTGTCCGTTCAACCGCCGACTCTGATATCTCTCAGCGGAAGCTATTCATCCGT
GGTCTCGCGGCGGATACTACCACGGAAGGTCTTCTTTCGCTTTTTTCCAATTACGGAGATCTCGAAGAAGCTATTGTGAT
CCTTGACAAGGTCACTGGGAAATCCAAAGGTTATGGTTTCGTCACTTTTATGCACGTTGATGGAGCTCTACTAGCTTTGA
AAGAACCATCTAAGAAAATTGATGGGCGTGTCACAGTAACGCAGCTCGCGGCTTCTGGAAATCAAGGTACGGGCTCCCAG
ATTGCAGATATATCAATGAGGAAGATCTATGTGGCGAATGTTCCGTTTGATATGCCGGCGGATAGGCTATTGAATCACTT
TATGGCTTATGGAGATGTTGAGGAAGGTCCTTTGGGTTTTGATAAGGTTACGGGTAAATCTAGAGGCTTTGCATTGTTTG
TCTACAAGACAGCTGAAGGTGCGCAGACTGCTCTTGCTGATCCGGTGAAAGTGATTGATGGAAAACATTTGAATTGTAAG
TTGGCTGTTGATGGTAAGAAAGGAGGAGGGAAGCCTGGAATGCCGCAAGCTCAGGATGGTGGTTCTGGTCATGGACACGT
TCATGGTGATGTAATGGGAATGGTGCGTCCTGCAGGACCTTATGGTGCAGCTGGTGGCATGAGTGCTTATGGTGGGTACT
CGGGAGGACCACCACCGCATCACATGAATTCCACACCCTCTTCAATGGGTGTTGGTACTGGTGGGTATGGTGGACACTAT
GGTGGATATGGAGGTCCAGGTGGTACTGGCGGCTACGGTGGACTTGGCAGTGGGTATGGTGGGCCTGGTGGTGGAAGTGG
GCCGTATAGAATGCCACCAAGTTCGATGCCTGGTGGTGGTTATCCCGAGAGTGGGCACTATGGTCTTTCATCATCTACTG
GATATCCTGGACAGCATCATCAAGCTGTTGGAACCTCCCCTGTGCCAAGAGTTCCGCATGGAGGAATGTACCCAAACGGT
CCACCAAACTACTGA