Details for Lyrate rockcress Locus 16065886

Position : sca3 ( 5`- 9505634 .. 9497541 -3` )
Annotation : [B2G] always early protein 3
External links : CoGe
PGDD synteny : 16065886

Protein [Map View]
MAPSRSKKSKYKKKPRAKAISPHKDEDSMSKTKQRKRKLSDMLGPQWSKEELERFYEGYRKFGKEWKKVAAFVHSRSAEM
VEALYTMNKAYLSLPEGTASVVGLNAMMTDHYSVLHGGSDSEQENNEGIETPRSAPKRSRVKSSDNPSIGLEGLSDRLQF
RSSSGFMPSLKKRRTETVPRAVGKRTPRIPISYTLEKDTRERYLSPVKRGLNQKGDDTDDDMEHEIALALAEASQRGGST
KNSHTPNRKAKMYPPDKKGERMRADIDLAIAKLHATDMEDVRCEPSLGSTEADNGDYSGGRNDLMHGEGSSAVEKQQKGR
TYYRRRLGIKEEDAKEACSGTDEAPSLGAPDEKFEPERDGKSLKFTYKVSRRKSKKSLFTADEDTACDALQTLADLSLMM
PETATDTESSVQAEEKRAGKAYVSDFKGTDPASMSKSSSLRNSKQRRSGTNDLCDTEPERKSPSSSLIRKRRQKVLPAKV
REDVLKDELAASSKVIEPCNNKGIGEENKPVGRGKRSASIRNSHEKKSVKPHDRTSSSNNIVEEDESAPSNAVIKKQVNL
PTKVRSRRKIVTEKPLTIDDGKISETLEKFSHYTSSFRARRWCLFEWFYSAIDYPWFARQEFVEYLDHVGLGHVPRLTRV
EWGVIRSSLGKPRRFSEQFLKEEKEKLYLYRDSVRKHYDELNTGMREGLPMDLARPLNVSQRVISLHPKSREIHDGSVLT
VDHCRYRIQFDHPELGVEFVKDTECMPLNPLENMPASLARHYAFSNYNIQNPVEEKMHERAKESMLEGYSKLSCETGRLL
PSPNYNVSNSLKQEKVDISSSNPQAQDGVDEALDLQLFNSQPSSIGHIQAREADVQALSELTRALDKKELVLRELKCMND
EVVESQKDGHNALKDSESFKKQYAAVLFQLSEINEQVSLALLGLRQRNTYQENVPYASTKRMNKSGEPDGQLTYVDNYVS
DTNGFHVSEIVESSRIKARKMVYRAVQALALLRKDENNNVNMEEAIDFVNNQLSIDQTEGSSVQQTQGAQDQRLPSTPNP
PSSTPANDSHLNPPDQNDLQIPSELVSRCMATLLMIQKCTERQFPPSEVAQVLDSAVASLQPCCSQNLPIYTEIQKCMGI
IRNQILALVPS*

DNA
ATGGCGCCCTCAAGATCAAAGAAATCTAAGTACAAGAAAAAGCCCCGTGCTAAAGCTATTTCTCCTCACAAAGACGAAGA
TAGTATGAGCAAAACCAAACAACGGAAGAGGAAGCTGTCAGATATGTTAGGTCCTCAGTGGAGCAAGGAAGAGTTGGAGC
GCTTTTATGAAGGATACCGCAAATTCGGAAAAGAATGGAAAAAGGTGGCTGCATTTGTACATAGCCGTTCTGCAGAAATG
GTAGAGGCCCTATACACTATGAATAAGGCTTACTTGTCTCTTCCGGAAGGCACTGCTTCTGTGGTTGGCCTAAATGCAAT
GATGACGGATCACTACTCTGTTTTGCATGGAGGAAGTGACAGTGAGCAGGAAAACAATGAAGGTATTGAAACTCCGAGGT
CAGCCCCTAAGCGCTCTAGAGTAAAATCCTCAGATAATCCCTCTATAGGACTAGAGGGTCTGTCTGACCGCTTGCAATTT
AGGTCCTCCTCAGGCTTCATGCCGTCACTGAAGAAGAGACGTACTGAGACTGTGCCTCGTGCTGTTGGAAAAAGGACACC
TAGAATTCCTATCTCATATACCCTTGAGAAGGATACTAGGGAAAGATATTTATCACCTGTTAAGAGAGGTCTAAATCAGA
AGGGGGATGATACTGATGACGATATGGAACATGAGATAGCATTAGCATTGGCTGAGGCTTCACAGCGAGGTGGCTCTACA
AAGAATTCCCACACACCAAATAGAAAAGCAAAGATGTACCCCCCTGATAAAAAGGGTGAAAGAATGCGTGCCGATATTGA
CTTGGCGATTGCCAAGCTTCATGCCACTGATATGGAAGATGTCCGCTGTGAACCAAGCTTAGGAAGCACTGAAGCTGATA
ATGGGGATTATTCTGGAGGTAGAAATGACTTGATGCATGGAGAAGGTTCTAGTGCCGTGGAAAAGCAGCAAAAAGGAAGA
ACGTACTATAGGAGGAGATTAGGCATTAAAGAAGAAGATGCAAAAGAAGCCTGCAGTGGTACAGACGAAGCACCAAGCTT
AGGCGCTCCCGATGAGAAATTTGAACCAGAAAGGGATGGGAAGTCTTTGAAATTCACGTATAAAGTTTCAAGGAGAAAAA
GTAAAAAAAGTCTCTTTACTGCAGATGAAGACACAGCATGTGATGCTCTCCAGACGCTGGCAGATCTATCGCTGATGATG
CCTGAAACTGCTACAGATACTGAGTCATCAGTTCAAGCTGAGGAAAAGAGAGCTGGAAAAGCTTATGTTTCAGATTTTAA
AGGGACTGATCCAGCATCCATGTCTAAAAGTAGTTCTCTTAGAAACTCCAAACAGAGAAGATCCGGCACCAATGACCTTT
GTGATACTGAACCCGAGCGAAAGAGTCCAAGTAGCTCTTTAATTCGAAAGAGACGGCAGAAAGTATTACCAGCTAAAGTA
AGAGAAGATGTTCTTAAAGATGAGCTTGCTGCAAGCTCAAAAGTCATAGAGCCTTGTAATAACAAGGGAATAGGTGAGGA
AAATAAGCCTGTTGGTAGAGGTAAACGGTCAGCAAGTATTCGAAACTCACATGAAAAGAAGTCTGTCAAACCTCATGATC
GTACTTCGTCAAGTAACAACATAGTAGAAGAAGATGAGTCAGCTCCATCAAATGCAGTCATTAAAAAACAAGTTAACTTG
CCAACTAAAGTTAGGAGCAGAAGAAAGATAGTAACTGAGAAACCTCTAACTATTGATGACGGGAAAATTTCTGAGACTCT
AGAGAAGTTTTCGCATTACACATCTAGTTTCCGAGCACGAAGATGGTGTCTTTTTGAGTGGTTCTACAGTGCAATTGACT
ATCCATGGTTTGCCAGACAAGAGTTTGTTGAGTATTTGGATCATGTAGGGTTGGGTCATGTTCCTAGATTAACTCGCGTT
GAATGGGGTGTCATAAGGAGTTCTCTTGGGAAACCGAGGCGATTTTCTGAACAGTTTTTGAAGGAGGAAAAAGAAAAGCT
ATACCTATACAGGGACTCTGTAAGAAAACATTATGATGAACTAAACACGGGCATGAGGGAAGGACTTCCAATGGATTTGG
CCCGGCCTCTTAATGTTTCACAGAGAGTCATTTCCCTGCATCCAAAGTCAAGAGAGATTCATGACGGCAGTGTCCTAACT
GTTGATCACTGTAGGTACCGGATTCAGTTTGACCACCCTGAATTAGGGGTAGAATTTGTTAAGGATACTGAATGCATGCC
ACTGAATCCTCTAGAAAACATGCCAGCATCGCTGGCAAGGCACTATGCTTTCTCAAATTATAACATTCAGAATCCCGTTG
AGGAGAAAATGCATGAGCGGGCAAAGGAAAGCATGTTGGAAGGATATTCCAAACTTTCTTGTGAGACTGGCCGTCTCTTA
CCCTCACCAAATTATAACGTTAGCAATTCACTAAAGCAGGAAAAGGTAGATATCTCAAGTTCAAATCCACAAGCTCAAGA
TGGAGTCGATGAGGCTCTTGATTTACAATTGTTTAATTCTCAGCCCTCAAGTATTGGACATATCCAGGCAAGAGAAGCTG
ATGTCCAAGCTCTTTCTGAACTAACACGTGCACTTGACAAGAAGGAGCTAGTTTTGAGGGAGCTAAAATGCATGAACGAC
GAGGTTGTGGAAAGTCAGAAAGATGGACATAATGCTCTGAAGGATTCCGAATCTTTTAAGAAACAATATGCAGCAGTTCT
CTTTCAGCTAAGCGAAATCAATGAGCAGGTTTCATTGGCACTTCTTGGCTTGAGGCAACGAAATACTTACCAGGAGAATG
TGCCATATGCATCAACAAAACGCATGAATAAATCAGGGGAACCTGATGGTCAGTTAACCTACGTAGACAATTATGTATCT
GACACTAATGGATTCCATGTGTCTGAGATCGTCGAAAGTTCTAGAATAAAAGCACGGAAAATGGTATACAGAGCTGTACA
GGCATTGGCATTACTGAGGAAAGACGAAAATAATAATGTAAATATGGAAGAAGCCATTGATTTTGTAAATAATCAGCTCT
CAATAGATCAAACAGAAGGATCATCAGTCCAGCAAACACAAGGTGCCCAGGATCAGCGCCTTCCCTCTACACCAAATCCA
CCTAGCTCAACTCCTGCCAATGATTCCCACCTAAACCCACCCGATCAAAATGACCTGCAAATCCCGTCTGAACTTGTGTC
CCGATGTATGGCTACATTGCTTATGATTCAGAAATGTACAGAGAGGCAATTCCCACCAAGTGAAGTGGCCCAGGTTCTAG
ACTCTGCGGTGGCAAGTTTACAGCCTTGCTGCTCACAAAACCTTCCTATCTATACAGAGATTCAGAAGTGCATGGGAATC
ATAAGAAACCAGATTCTAGCCCTCGTACCCTCCTAA