Details for Lyrate rockcress Locus 16065809

Position : sca3 ( 5`- 8480508 .. 8483235 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065809

Protein [Map View]
MTTTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGAVLDCCFHDDFSGFSVGADYKV
RRIVFNVGKEDILGTHDKPVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVAT
AGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIV
YPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEAIFVR
SVNEIEVKPKPKVYPNPAA*

DNA
ATGACTACGACTCCGTCCGCCGGTCGTGAGCTCTCGAATCCGCCGTCCGACGGCATTTCCAATCTCCGATTTTCCAATAA
CAGTGATCATCTCCTCGTTTCTTCATGGGATAAGCGTGTGAGATTGTATGATGTGAGCACCAATTCGTTGAAAGGGGAGT
TCTTACATGGCGGAGCAGTGCTCGATTGCTGTTTTCACGATGATTTCTCCGGCTTCAGTGTTGGCGCCGATTACAAAGTC
AGAAGGATTGTATTCAATGTCGGCAAAGAGGACATTTTGGGGACACATGACAAACCAGTGCGATGTGTTGAGTATTCTTA
TGCTGCAGGGCAAGTGATCACTGGATCTTGGGATAAAACAGTTAAATGTTGGGATCCAAGAGGCGCAAGTGGGCCTGAAC
GCACCCAGGTAGGAACATATTTGCAGCCAGAGCGTGTTTACTCTATGTCTCTTGTTGGACATCGTTTGGTAGTGGCAACA
GCAGGAAGGCATGTAAACATCTATGATCTCAGAAATATGTCTCAGCCTGAGCAAAGAAGAGAGTCTTCACTGAAATACCA
GACGAGATGTGTGCGTTGTTATCCTAATGGAACAGGATATGCTCTTAGCTCTGTTGAAGGAAGGGTTGCTATGGAGTTTT
TTGATCTGTCAGAAGCTGCTCAAGCTAAAAAATATGCTTTCAAATGTCATCGGAAATCAGAGGCTGGAAGGGACATTGTT
TACCCTGTAAATTCCATTGCCTTCCATCCAATCTATGGCACCTTTGCAACTGGAGGTTGTGATGGTTTCGTCAACATTTG
GGATGGTAACAACAAGAAGAGGTTATATCAGTACTCAAAGTATCCAACAAGTATCTCGGCACTGTCATTCAGTCGAGATG
GTCAGCTACTGGCTGTTGCTTCAAGTTACACGTTTGAAGAGGGGGAGAAATCGCAAGAACCAGAGGCCATCTTTGTAAGA
AGCGTGAACGAAATCGAAGTGAAACCAAAACCCAAAGTATACCCGAATCCTGCGGCCTAG