Details for Lyrate rockcress Locus 16065790

Position : sca3 ( 5`- 3218485 .. 3219874 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478095 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065790

Protein [Map View]
MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRCVEERVSLCQNCDWSGHNNNS
SSSSTSPQQHKRQTISCYSGCPSSSELASIWSFCLDLAGQSICEQEMGMMNIDDDGPTDNKNCNEDKKDVFVSIPETSSA
AKGKSSSAKDVGVCEDDFYGNLGMDEVDMALENYEELFGTAFNPSEELFGHGGIDSLFQKHQTKAPEGGNSVHPAGSNDS
FMSSKTEPIICYTSKPAQSNISFSGVTGESSAGDFQECGASSSIQLSGEPPWYPPTSQENNACSHSVTRNNAVMRYKEKK
KARKFDKRVRYASRKARADVRRRVKGRFVKAGEAYDYDPLTPTRSY*

DNA
ATGGGTTACATGTGTGACTTCTGTGGTGAACAAAGATCTATGGTGTACTGTCGATCCGATGCAGCTTGTCTGTGTCTCTC
CTGTGACCGGAGTGTTCATTCCGCTAATGCATTGTCCAAACGGCATTCTCGGACACTTGTCTGCGAGAGATGCAATGCTC
AGCCTGCTACTGTCAGGTGTGTTGAAGAAAGGGTCTCACTCTGTCAAAACTGTGATTGGTCCGGCCACAACAACAATTCT
TCGTCTTCTTCTACTTCGCCGCAGCAGCATAAGAGGCAAACCATAAGTTGCTATTCGGGTTGCCCTTCGAGCTCAGAACT
CGCATCCATTTGGTCCTTCTGTTTGGACTTAGCCGGACAATCCATTTGTGAACAAGAAATGGGTATGATGAATATAGACG
ATGATGGTCCTACCGACAACAAAAATTGTAATGAAGATAAGAAAGATGTCTTTGTTTCAATTCCTGAAACCAGTTCTGCA
GCAAAAGGAAAGTCATCTTCTGCTAAGGATGTTGGAGTGTGTGAAGATGATTTCTACGGGAACCTTGGTATGGATGAAGT
TGATATGGCACTTGAGAACTATGAAGAGCTCTTTGGTACCGCCTTTAACCCCTCGGAAGAGCTATTTGGGCATGGTGGAA
TCGATAGTCTTTTCCAGAAGCACCAAACAAAAGCTCCAGAGGGAGGGAATTCGGTGCATCCAGCTGGCAGTAATGATTCG
TTCATGAGTTCGAAAACTGAGCCAATAATTTGCTACACATCGAAGCCAGCACAATCGAACATATCGTTCTCTGGAGTCAC
TGGAGAAAGTAGTGCTGGAGATTTCCAAGAATGTGGTGCATCATCTTCGATACAGCTCTCTGGCGAGCCACCATGGTATC
CTCCAACATCTCAAGAAAATAATGCCTGCTCACATTCAGTAACCCGTAATAATGCAGTTATGCGATACAAGGAAAAGAAG
AAGGCTCGCAAGTTTGATAAGAGAGTGAGGTATGCTTCTCGCAAAGCAAGAGCTGATGTGAGACGGCGTGTAAAGGGGAG
ATTTGTCAAAGCTGGTGAAGCTTATGATTACGACCCCCTCACCCCAACCAGAAGCTATTGA