Details for Lyrate rockcress Locus 16065749

Position : sca2 ( 5`- 15866258 .. 15865570 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16065749

Protein [Map View]
MTEFYVSLFISNVASHLSPTFDNIPSKKIVPTPIEKDVSLVSRTGRDLQRYNTAGYRQVVGCVPYRYKKHGGGEIEVLLI
SAQKKGKGMLLPKGGWEIDESIEEAALRETIEEAGVTGQLEESLGKWQYKSKRHSMIHDGYMFPLLVSQQFERWPEADIR
QRKWVSLSEAIELCQNSWMREALEAFINRKCQTN*

DNA
ATGACTGAATTCTATGTTTCTCTATTCATCTCAAACGTCGCTTCTCACTTATCTCCGACATTTGATAACATCCCGTCGAA
GAAAATCGTACCGACACCGATTGAGAAAGATGTCTCTTTAGTCTCTCGTACCGGACGAGATCTGCAACGTTACAACACTG
CAGGGTATCGTCAAGTCGTCGGATGTGTACCGTATAGATACAAGAAACATGGTGGAGGAGAAATTGAAGTGCTTTTGATA
AGTGCACAGAAGAAAGGGAAAGGAATGTTACTACCTAAAGGAGGTTGGGAGATTGATGAATCAATTGAAGAAGCTGCTTT
AAGAGAGACGATTGAAGAAGCTGGTGTTACGGGTCAGCTTGAAGAATCACTTGGGAAATGGCAATACAAAAGCAAAAGAC
ATAGTATGATTCATGATGGTTACATGTTTCCTTTGCTTGTTAGTCAACAGTTTGAGCGATGGCCTGAAGCTGACATTAGA
CAACGTAAATGGGTTTCTTTGTCTGAAGCGATTGAGTTGTGTCAGAATTCGTGGATGAGAGAAGCTTTGGAAGCTTTTAT
TAACCGGAAATGTCAGACCAACTAA