Details for Lyrate rockcress Locus 16065740

Position : sca3 ( 5`- 7065467 .. 7069401 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16065740

Protein [Map View]
MTMLSLSTEVDTQSLKKLSLKSVTRARELFSPVHGQFPPPDPESKRIRLCHKIQVSFGGVEPASKPTRSAEHNSEKTAPS
NALALPGPEGSKELRKGTTEKALVVGPTLPSRDLNNTGNPGKSTAILPASGSFSERNLSTAALMERMPSRWPRPEWHAPW
KNYRVIQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWD
LEQNKVIRSYHGHLHGVYCLALHPTLDVILTGGRDSVCRVWDIRTKMQIFVLPHNADVFSVLARPTDPQVITGSHDSTIK
FWDLRFGKSMLNITNHKKTVRAMALHPKENAFVSASADNIKKFSLPKGEFCHNMLSLQRDTINAVAANEDGVMATEGDKG
GLWFWDWKSGHNFQQAETIVQPGSLESEAGIYAACYDRTGSRLVTCEADKTIKMWKEDENATPETHPLNFKPPKEIRRF*

DNA
ATGACGATGCTAAGTTTGAGCACGGAAGTCGATACTCAGTCACTGAAAAAACTCAGTCTCAAATCTGTAACACGAGCTCG
TGAACTTTTCTCCCCCGTCCATGGCCAATTTCCTCCTCCTGATCCTGAAAGCAAAAGAATTCGGCTCTGCCATAAGATTC
AAGTTTCATTTGGAGGCGTAGAACCTGCAAGTAAGCCTACACGTAGTGCTGAACATAACAGTGAAAAGACGGCTCCATCG
AATGCCCTTGCCCTTCCAGGTCCAGAAGGTTCCAAGGAACTTCGAAAAGGCACAACAGAGAAAGCTTTAGTTGTTGGTCC
AACTTTACCGTCAAGAGACTTGAACAATACTGGTAATCCAGGCAAAAGCACGGCCATTCTTCCTGCATCTGGATCCTTTT
CTGAAAGAAATCTGTCAACTGCTGCTTTAATGGAGAGAATGCCTAGTAGATGGCCTCGTCCAGAGTGGCATGCACCATGG
AAGAATTACAGGGTGATCCAGGGACACTTGGGTTGGGTCAGATCTGTTGCGTTTGACCCAAGTAATGAATGGTTTTGCAC
TGGTTCAGCTGATCGTACCATCAAGATATGGGATGTAGCGACCGGAGTTCTGAAACTCACACTTACTGGACATATAGGGC
AAGTACGAGGCCTCGCTGTAAGCAATAGACATACCTATATGTTTTCTGCTGGTGATGACAAGCAAGTCAAATGCTGGGAC
CTTGAGCAGAATAAGGTTATTCGATCTTATCATGGTCATTTGCATGGCGTTTACTGTTTAGCTCTTCATCCAACGCTAGA
TGTTATACTAACCGGAGGGCGAGACTCTGTCTGCAGGGTATGGGATATCCGTACGAAGATGCAAATTTTTGTACTCCCAC
ATAACGCAGATGTTTTTTCCGTTTTAGCCCGTCCAACTGATCCACAAGTTATTACAGGGTCTCATGACTCAACCATCAAA
TTTTGGGATCTCCGATTTGGCAAATCGATGCTAAATATAACGAATCATAAGAAGACTGTCCGAGCAATGGCTCTCCATCC
GAAAGAGAATGCTTTTGTTTCTGCATCAGCTGACAATATCAAGAAGTTTAGCCTTCCTAAGGGAGAGTTTTGCCACAACA
TGCTTTCTCTGCAGAGAGACACAATTAACGCAGTGGCTGCGAACGAGGATGGCGTAATGGCCACTGAAGGTGATAAAGGT
GGCTTATGGTTCTGGGACTGGAAGAGTGGTCACAATTTCCAACAGGCAGAAACTATTGTACAGCCCGGTTCGCTGGAGAG
TGAAGCCGGTATATATGCAGCGTGTTACGATAGGACGGGTTCAAGGCTGGTAACGTGTGAGGCAGACAAAACAATAAAGA
TGTGGAAGGAAGACGAGAATGCAACTCCTGAAACTCATCCTCTCAACTTCAAACCTCCCAAAGAGATCAGACGCTTCTGA